Basic Info

Gene ID OGI # | Score   Accession | Assembly | Annotation Location Links
OsLiXu_10g0004740 OGI:10020000 | 16/16 LIU XU | Os125827RS1 | Gramene(+IsoSeq) Chr10:6600674-6601064
Gene Symbol -
DNA seq

cgtgtggccggcagccgaccatgctagctgcagcatggccacaacaacaagaacagcctcgtcgagtgggtacaggactcgttccgccacaggaaatcagtcaccgatatggcagacgagaggctgaagggtgatttcgatgaggagcagattgagcgggtgatccgggttgggttcctgtgtgtgcttccggagcctgacaagcggccggacatggcgacggtggtggactacctgaaaggaaggagcgatgtgcctgcagcagagccatatcctgcaagtccagctagcattcatgctgctaacaagtatgaatcgtcaccggcctctctgctcgttagctgagaccttaatgctagtcgtgactagcatgaactcaacagaatgcgac

CDS seq

atggcagacgagaggctgaagggtgatttcgatgaggagcagattgagcgggtgatccgggttgggttcctgtgtgtgcttccggagcctgacaagcggccggacatggcgacggtggtggactacctgaaaggaaggagcgatgtgcctgcagcagagccatatcctgcaagtccagctagcattcatgctgctaacaagtatgaatcgtcaccggcctctctgctcgttagctga

Protein seq

MADERLKGDFDEEQIERVIRVGFLCVLPEPDKRPDMATVVDYLKGRSDVPAAEPYPASPASIHAANKYESSPASLLVS

Function -

Transcripts

Gene Transcript Chromosome Start End Strand Source
OsLiXu_10g0004740 OsLiXu_10g0004740.01 Chr10 6600674 6601064 + NAM
CDS seq

atggcagacgagaggctgaagggtgatttcgatgaggagcagattgagcgggtgatccgggttgggttcctgtgtgtgcttccggagcctgacaagcggccggacatggcgacggtggtggactacctgaaaggaaggagcgatgtgcctgcagcagagccatatcctgcaagtccagctagcattcatgctgctaacaagtatgaatcgtcaccggcctctctgctcgttagctga

More
Protein seq

MADERLKGDFDEEQIERVIRVGFLCVLPEPDKRPDMATVVDYLKGRSDVPAAEPYPASPASIHAANKYESSPASLLVS

Event Type Chromosome Start End Strand Alternative mRNAs Total mRNAs Source

Expression

Leaf Root Panicle
FPKM 0.0 0.0 0.0

Homologues

Genome & Annotation Homologs Type Expression(FPKM)
Leaf Root Panicle
Nipponbare | IRGSP 1.0 | Gramene(+IsoSeq) OsNip_10g0441900 SBH 0.317863 0.391611 1.577385
Nipponbare | IRGSP 1.0 | MSU LOC_Os10g10540 SBH 0.0 0.0 0.0
Nipponbare | IRGSP 1.0 | RAP-db Os10g0442000 SBH None None None
Azucena | AzucenaRS1 | Gramene(+IsoSeq) OsAzu_10g0005240 SBH 0.0 0.0 0.000000
KETAN NANGKA | Os128077RS1 | Gramene(+IsoSeq) OsKeNa_10g0004740 SBH 0.0 0.0 0.0
CHAO MEO | Os132278RS1 | Gramene(+IsoSeq) OsCMeo_10g0004660 SBH 0.0 0.0 0.0
ARC 10497 | Os117425RS1 | Gramene(+IsoSeq) OsARC_10g0005020 RBH 0.0 0.0 None
PR 106 | Os127742RS1 | Gramene(+IsoSeq) OsPr106_10g0004770 SBH 0.0 0.000000 0.712856
Minghui 63 | MH63RS3 | HZAU NA NA NA NA NA
IR 64 | OsIR64RS1 | Gramene(+IsoSeq) OsIR64_10g0004950 SBH 0.0 0.0 0.026410
Zhenshan 97 | ZS97RS3 | HZAU OsZS97_10G0110500 SBH 0 0.025334 0
LIMA | Os127564RS1 | Gramene(+IsoSeq) OsLima_10g0004820 SBH 0.0 0.0 None
KHAO YAI GUANG | Os127518RS1 | Gramene(+IsoSeq) OsKYG_10g0004840 RBH 0.0 0.0 None
GOBOL SAIL | Os132424RS1 | Gramene(+IsoSeq) OsGoSa_10g0005000 RBH 0.0 0.0 None
LIU XU | Os125827RS1 | Gramene(+IsoSeq) OsLiXu_Ung0057830 SBH 0.0 0.0 0.0
LARHA MUGAD | Os125619RS1 | Gramene(+IsoSeq) OsLaMu_10g0005100 RBH 0.0 0.0 None
N22 | OsN22RS2 | Gramene(+IsoSeq) OsN22_10G004890 SBH 0.0 0.0 0.0
NATEL BORO | Os127652RS1 | Gramene(+IsoSeq) OsNaBo_10g0004940 SBH 0.0 0.000000 0.0
Powered by

© 2021- Rice Gene Index @Zhang Lab. All Rights Reserved.

National Key Laboratory of Crop Genetic Improvement

Huazhong Agricultural University

Any comments and suggestions, please contact us.