Basic Info

Gene ID OGI # | Score   Accession | Assembly | Annotation Location Links
OsLaMu_12g0002130 OGI:12002730 | 16/16 LARHA MUGAD | Os125619RS1 | Gramene(+IsoSeq) Chr12:1523994-1524329
Gene Symbol MYB11, OsMyb11, Myb11, OsMYB60, MYB60
DNA seq

tcatgccggcgccggcgcctgcagggatgggaagccgacagtgctggccgtcgtgttcagctcgcttgccgcggcaacgctggtcccggcgctaactggctgatgcgtctgcggatcgatgccctggctcatgagcttgcgcttgatgtgcgtgttccacctgcagaaccaatcaatcagcaccaagaacacaagaagagctaaccggagcagatgacaacacgttgaaatttgttttgcttacttgttgccgagaagggcgtggagcttgatggtgagctcgtcgtcgtcgtcggtgaagttgctgcacttgaggtcggggctgaggtagttcat

CDS seq

atgaactacctcagccccgacctcaagtgcagcaacttcaccgacgacgacgacgagctcaccatcaagctccacgcccttctcggcaacaagtggaacacgcacatcaagcgcaagctcatgagccagggcatcgatccgcagacgcatcagccagttagcgccgggaccagcgttgccgcggcaagcgagctgaacacgacggccagcactgtcggcttcccatccctgcaggcgccggcgccggcatga

Protein seq

MNYLSPDLKCSNFTDDDDELTIKLHALLGNKWNTHIKRKLMSQGIDPQTHQPVSAGTSVAAASELNTTASTVGFPSLQAPAPA

Function Transcription repressor MYB6 [UniProtKB/Swiss-Prot:Q38851]

Transcripts

Gene Transcript Chromosome Start End Strand Source
OsLaMu_12g0002130 OsLaMu_12g0002130.01 Chr12 1523994 1524329 - NAM
CDS seq

atgaactacctcagccccgacctcaagtgcagcaacttcaccgacgacgacgacgagctcaccatcaagctccacgcccttctcggcaacaagtggaacacgcacatcaagcgcaagctcatgagccagggcatcgatccgcagacgcatcagccagttagcgccgggaccagcgttgccgcggcaagcgagctgaacacgacggccagcactgtcggcttcccatccctgcaggcgccggcgccggcatga

More
Protein seq

MNYLSPDLKCSNFTDDDDELTIKLHALLGNKWNTHIKRKLMSQGIDPQTHQPVSAGTSVAAASELNTTASTVGFPSLQAPAPA

Event Type Chromosome Start End Strand Alternative mRNAs Total mRNAs Source

Expression

Leaf Root Panicle
FPKM 0.0 0.0 None

Homologues

Genome & Annotation Homologs Type Expression(FPKM)
Leaf Root Panicle
Nipponbare | IRGSP 1.0 | Gramene(+IsoSeq) OsNip_02g0189566 SBH 0.0 0.0 0.0
Nipponbare | IRGSP 1.0 | MSU LOC_Os12g02430 RBH 0.0 0.0 0.0
Nipponbare | IRGSP 1.0 | RAP-db Os02g0189566 SBH None None None
Azucena | AzucenaRS1 | Gramene(+IsoSeq) OsAzu_12g0001030 RBH 0.0 0.0 0.0
KETAN NANGKA | Os128077RS1 | Gramene(+IsoSeq) OsKeNa_12g0001240 RBH 0.0 0.0 0.0
CHAO MEO | Os132278RS1 | Gramene(+IsoSeq) OsCMeo_12g0001250 RBH 0.0 0.0 0.0
ARC 10497 | Os117425RS1 | Gramene(+IsoSeq) OsARC_12g0001070 RBH 0.0 0.0 None
PR 106 | Os127742RS1 | Gramene(+IsoSeq) OsPr106_12g0001360 RBH 0.0 0.0 0.0
Minghui 63 | MH63RS3 | HZAU OsMH63_12G0015200 RBH 0 0 0
IR 64 | OsIR64RS1 | Gramene(+IsoSeq) OsIR64_12g0001340 RBH 0.0 0.0 0.0
Zhenshan 97 | ZS97RS3 | HZAU OsZS97_12G0015500 RBH 0 0 0
LIMA | Os127564RS1 | Gramene(+IsoSeq) OsLima_12g0001060 RBH 0.0 0.0 None
KHAO YAI GUANG | Os127518RS1 | Gramene(+IsoSeq) OsKYG_12g0001400 RBH 0.0 0.0 None
GOBOL SAIL | Os132424RS1 | Gramene(+IsoSeq) OsGoSa_12g0001370 RBH 0.0 0.0 None
LIU XU | Os125827RS1 | Gramene(+IsoSeq) OsLiXu_12g0001180 RBH 0.0 0.0 0.0
LARHA MUGAD | Os125619RS1 | Gramene(+IsoSeq) OsLaMu_03g0010330 RBH 0.0 0.0 None
N22 | OsN22RS2 | Gramene(+IsoSeq) OsN22_12G002040 RBH 0.0 0.0 0.0
NATEL BORO | Os127652RS1 | Gramene(+IsoSeq) OsNaBo_12g0002260 RBH 0.0 0.0 0.0
Powered by

© 2021- Rice Gene Index @Zhang Lab. All Rights Reserved.

National Key Laboratory of Crop Genetic Improvement

Huazhong Agricultural University

Any comments and suggestions, please contact us.