Basic Info

Gene ID OGI # | Score   Accession | Assembly | Annotation Location Links
OsPr106_06g0014080 OGI:11068020 | 16/16 PR 106 | Os127742RS1 | Gramene(+IsoSeq) Chr06:12984654-12984833
Gene Symbol -
DNA seq

atgcaggacttggcagccttgctgcaggagctggcaaaggagaaggaagaagaggcggcaacgggactagccatgatgccgacggttgacatgccttcaattcagttgatcccgccggcagcctgcatggtggagcacgaagtggtggtgcagcaaaaaaacagagatgagtatgactaa

CDS seq

atgcaggacttggcagccttgctgcaggagctggcaaaggagaaggaagaagaggcggcaacgggactagccatgatgccgacggttgacatgccttcaattcagttgatcccgccggcagcctgcatggtggagcacgaagtggtggtgcagcaaaaaaacagagatgagtatgactaa

Protein seq

MQDLAALLQELAKEKEEEAATGLAMMPTVDMPSIQLIPPAACMVEHEVVVQQKNRDEYD

Function -

Transcripts

Gene Transcript Chromosome Start End Strand Source
OsPr106_06g0014080 OsPr106_06g0014080.01 Chr06 12984654 12984833 + NAM
CDS seq

atgcaggacttggcagccttgctgcaggagctggcaaaggagaaggaagaagaggcggcaacgggactagccatgatgccgacggttgacatgccttcaattcagttgatcccgccggcagcctgcatggtggagcacgaagtggtggtgcagcaaaaaaacagagatgagtatgactaa

Protein seq

MQDLAALLQELAKEKEEEAATGLAMMPTVDMPSIQLIPPAACMVEHEVVVQQKNRDEYD

Event Type Chromosome Start End Strand Alternative mRNAs Total mRNAs Source

Expression

Leaf Root Panicle
FPKM 0.0 0.0 0.0

Homologues

Genome & Annotation Homologs Type Expression(FPKM)
Leaf Root Panicle
Nipponbare | IRGSP 1.0 | Gramene(+IsoSeq) NA NA NA NA NA
Nipponbare | IRGSP 1.0 | MSU LOC_Os06g30270 RBH 0.0 0.0 0.0
Nipponbare | IRGSP 1.0 | RAP-db NA NA NA NA NA
Azucena | AzucenaRS1 | Gramene(+IsoSeq) OsAzu_06g0014100 RBH 0.0 0.0 0.0
KETAN NANGKA | Os128077RS1 | Gramene(+IsoSeq) OsKeNa_06g0013910 RBH 0.0 0.0 0.0
CHAO MEO | Os132278RS1 | Gramene(+IsoSeq) OsCMeo_06g0014050 RBH 0.0 0.0 0.0
ARC 10497 | Os117425RS1 | Gramene(+IsoSeq) OsARC_06g0013990 RBH 0.0 0.0 None
PR 106 | Os127742RS1 | Gramene(+IsoSeq) NA NA NA NA NA
Minghui 63 | MH63RS3 | HZAU NA NA NA NA NA
IR 64 | OsIR64RS1 | Gramene(+IsoSeq) OsIR64_06g0013580 RBH 0.0 0.0 0.0
Zhenshan 97 | ZS97RS3 | HZAU NA NA NA NA NA
LIMA | Os127564RS1 | Gramene(+IsoSeq) NA NA NA NA NA
KHAO YAI GUANG | Os127518RS1 | Gramene(+IsoSeq) OsKYG_06g0014030 RBH 0.0 0.0 None
GOBOL SAIL | Os132424RS1 | Gramene(+IsoSeq) NA NA NA NA NA
LIU XU | Os125827RS1 | Gramene(+IsoSeq) OsLiXu_Ung0032810 RBH 0.0 0.0 0.0
LARHA MUGAD | Os125619RS1 | Gramene(+IsoSeq) NA NA NA NA NA
N22 | OsN22RS2 | Gramene(+IsoSeq) NA NA NA NA NA
NATEL BORO | Os127652RS1 | Gramene(+IsoSeq) OsNaBo_06g0014060 RBH 0.0 0.0 0.0
Powered by

© 2021- Rice Gene Index @Zhang Lab. All Rights Reserved.

National Key Laboratory of Crop Genetic Improvement

Huazhong Agricultural University

Any comments and suggestions, please contact us.