Basic Info

Gene ID OGI # | Score   Accession | Assembly | Annotation Location Links
OsNaBo_12g0006910 OGI:12016380 | 16/16 NATEL BORO | Os127652RS1 | Gramene(+IsoSeq) Chr12:5976149-5976355
Gene Symbol -
DNA seq

tcatggcacagtagtacgcgatgggcatggatattggcctggattgcaggtcggatacggagtcggaagctgtccactttgaagcaacacccttgcggcggaggccatcaccggcgcctccagcagcgccgccgccaagacgaacagcatcaggacgagcaccgctgccagccgccggtcaccggtggtcctgagcgccgccgccat

CDS seq

atggcggcggcgctcaggaccaccggtgaccggcggctggcagcggtgctcgtcctgatgctgttcgtcttggcggcggcgctgctggaggcgccggtgatggcctccgccgcaagggtgttgcttcaaagtggacagcttccgactccgtatccgacctgcaatccaggccaatatccatgcccatcgcgtactactgtgccatga

Protein seq

MAAALRTTGDRRLAAVLVLMLFVLAAALLEAPVMASAARVLLQSGQLPTPYPTCNPGQYPCPSRTTVP

Function -

Transcripts

Gene Transcript Chromosome Start End Strand Source
OsNaBo_12g0006910 OsNaBo_12g0006910.01 Chr12 5976149 5976355 - NAM
CDS seq

atggcggcggcgctcaggaccaccggtgaccggcggctggcagcggtgctcgtcctgatgctgttcgtcttggcggcggcgctgctggaggcgccggtgatggcctccgccgcaagggtgttgcttcaaagtggacagcttccgactccgtatccgacctgcaatccaggccaatatccatgcccatcgcgtactactgtgccatga

More
Protein seq

MAAALRTTGDRRLAAVLVLMLFVLAAALLEAPVMASAARVLLQSGQLPTPYPTCNPGQYPCPSRTTVP

Event Type Chromosome Start End Strand Alternative mRNAs Total mRNAs Source

Expression

Leaf Root Panicle
FPKM 0.0 0.0 0.0

Homologues

Genome & Annotation Homologs Type Expression(FPKM)
Leaf Root Panicle
Nipponbare | IRGSP 1.0 | Gramene(+IsoSeq) OsNip_12g0221400 RBH 0.327710 0.336074 11.181643
Nipponbare | IRGSP 1.0 | MSU LOC_Os12g11980 RBH 0.689315 0.0 6.147799
Nipponbare | IRGSP 1.0 | RAP-db Os12g0221400 RBH None None None
Azucena | AzucenaRS1 | Gramene(+IsoSeq) OsAzu_12g0007020 RBH 0.000000 0.0 0.000000
KETAN NANGKA | Os128077RS1 | Gramene(+IsoSeq) OsKeNa_12g0007110 RBH 0.000000 0.0 0.541815
CHAO MEO | Os132278RS1 | Gramene(+IsoSeq) OsCMeo_12g0007110 RBH 0.000000 0.0 0.000000
ARC 10497 | Os117425RS1 | Gramene(+IsoSeq) OsARC_12g0007100 RBH 0.0 0.0 None
PR 106 | Os127742RS1 | Gramene(+IsoSeq) OsPr106_12g0006940 SBH 0.0 0.0 11.148461
Minghui 63 | MH63RS3 | HZAU OsMH63_12G0089800 RBH 0.613916 0.097328 0.082869
IR 64 | OsIR64RS1 | Gramene(+IsoSeq) OsIR64_12g0006930 SBH 0.0 0.0 0.0
Zhenshan 97 | ZS97RS3 | HZAU OsZS97_12G0095700 SBH 1.0676785 1.5122965 0.083661
LIMA | Os127564RS1 | Gramene(+IsoSeq) OsLima_12g0006790 SBH 0.0 0.0 None
KHAO YAI GUANG | Os127518RS1 | Gramene(+IsoSeq) OsKYG_12g0007100 SBH 0.0 0.0 None
GOBOL SAIL | Os132424RS1 | Gramene(+IsoSeq) OsGoSa_12g0006950 SBH 0.0 0.0 None
LIU XU | Os125827RS1 | Gramene(+IsoSeq) OsLiXu_12g0006990 SBH 0.0 0.0 0.0
LARHA MUGAD | Os125619RS1 | Gramene(+IsoSeq) OsLaMu_12g0006880 SBH 0.0 0.0 None
N22 | OsN22RS2 | Gramene(+IsoSeq) OsN22_12G006900 RBH 0.000000 0.0 1.193115
NATEL BORO | Os127652RS1 | Gramene(+IsoSeq) OsNaBo_12g0006920 RBH 0.0 0.0 2.940714
Powered by

© 2021- Rice Gene Index @Zhang Lab. All Rights Reserved.

National Key Laboratory of Crop Genetic Improvement

Huazhong Agricultural University

Any comments and suggestions, please contact us.