Basic Info

Gene ID OGI # | Score   Accession | Assembly | Annotation Location Links
OsLiXu_12g0009410 OGI:12028490 | 14/16 LIU XU | Os125827RS1 | Gramene(+IsoSeq) Chr12:9888792-9889142
Gene Symbol OGR1, ogr1
DNA seq

atgctcagccgcgccgggagactagacgaggcagaggagctcgtcgcggcaatgccagtacaccccgatgagctcatctggggctcgctgctcgccgcatgccgcgcgcacggcgaagttgagcgcgccgagcgggtgatgcggcagcgcaccaccgacgccgatgcggacgccggcgactacgtgctgatgtcgaacacttacgtgtcgaatggccggcacggcgaggcggtgaaggtgaggaggcagatgaggaggaacgagatcgacaaggtccccggctgcagcctcatcgagatcgacggcgtcgtcaacgaattcgaagcaatcccagcaaattccatccgataa

CDS seq

atgctcagccgcgccgggagactagacgaggcagaggagctcgtcgcggcaatgccagtacaccccgatgagctcatctggggctcgctgctcgccgcatgccgcgcgcacggcgaagttgagcgcgccgagcgggtgatgcggcagcgcaccaccgacgccgatgcggacgccggcgactacgtgctgatgtcgaacacttacgtgtcgaatggccggcacggcgaggcggtgaaggtgaggaggcagatgaggaggaacgagatcgacaaggtccccggctgcagcctcatcgagatcgacggcgtcgtcaacgaattcgaagcaatcccagcaaattccatccgataa

Protein seq

MLSRAGRLDEAEELVAAMPVHPDELIWGSLLAACRAHGEVERAERVMRQRTTDADADAGDYVLMSNTYVSNGRHGEAVKVRRQMRRNEIDKVPGCSLIEIDGVVNEFEAIPANSIR

Function Pentatricopeptide repeat-containing protein At5g48910 [UniProtKB/Swiss-Prot:Q9FI80]

Transcripts

Gene Transcript Chromosome Start End Strand Source
OsLiXu_12g0009410 OsLiXu_12g0009410.01 Chr12 9888792 9889142 + NAM
CDS seq

atgctcagccgcgccgggagactagacgaggcagaggagctcgtcgcggcaatgccagtacaccccgatgagctcatctggggctcgctgctcgccgcatgccgcgcgcacggcgaagttgagcgcgccgagcgggtgatgcggcagcgcaccaccgacgccgatgcggacgccggcgactacgtgctgatgtcgaacacttacgtgtcgaatggccggcacggcgaggcggtgaaggtgaggaggcagatgaggaggaacgagatcgacaaggtccccggctgcagcctcatcgagatcgacggcgtcgtcaacgaattcgaagcaatcccagcaaattccatccgataa

More
Protein seq

MLSRAGRLDEAEELVAAMPVHPDELIWGSLLAACRAHGEVERAERVMRQRTTDADADAGDYVLMSNTYVSNGRHGEAVKVRRQMRRNEIDKVPGCSLIEIDGVVNEFEAIPANSIR

Event Type Chromosome Start End Strand Alternative mRNAs Total mRNAs Source

Expression

Leaf Root Panicle
FPKM 0.000000 0.0 0.000000

Homologues

Genome & Annotation Homologs Type Expression(FPKM)
Leaf Root Panicle
Nipponbare | IRGSP 1.0 | Gramene(+IsoSeq) OsNip_12g0270200 SBH 1.098725 0.769711 1.295363
Nipponbare | IRGSP 1.0 | MSU LOC_Os12g17080 SBH 0.613291 0.499360 0.290388
Nipponbare | IRGSP 1.0 | RAP-db Os12g0270200 SBH None None None
Azucena | AzucenaRS1 | Gramene(+IsoSeq) OsAzu_12g0009490 RBH 0.0 0.0 0.0
KETAN NANGKA | Os128077RS1 | Gramene(+IsoSeq) OsKeNa_12g0009680 RBH 0.0 0.0 0.0
CHAO MEO | Os132278RS1 | Gramene(+IsoSeq) OsCMeo_12g0009620 RBH 0.075487 0.0 0.0
ARC 10497 | Os117425RS1 | Gramene(+IsoSeq) OsARC_12g0009420 RBH 0.0 0.000000 None
PR 106 | Os127742RS1 | Gramene(+IsoSeq) OsPr106_12g0009320 RBH 1.491218 8.795460 0.0
Minghui 63 | MH63RS3 | HZAU OsMH63_12G0146900 RBH 0.026991 0.1853765 0.019875
IR 64 | OsIR64RS1 | Gramene(+IsoSeq) OsIR64_12g0009320 RBH 0.000000 0.000000 0.000000
Zhenshan 97 | ZS97RS3 | HZAU OsZS97_12G0161100 RBH 0.351975 0.68399 2.467217
LIMA | Os127564RS1 | Gramene(+IsoSeq) OsLima_12g0009240 RBH 0.000000 0.000000 None
KHAO YAI GUANG | Os127518RS1 | Gramene(+IsoSeq) OsKYG_12g0009470 RBH 0.0 0.0 None
GOBOL SAIL | Os132424RS1 | Gramene(+IsoSeq) OsGoSa_12g0009440 RBH 0.0 0.000000 None
LIU XU | Os125827RS1 | Gramene(+IsoSeq) OsLiXu_08g0025720 RBH 0.0 0.0 0.0
LARHA MUGAD | Os125619RS1 | Gramene(+IsoSeq) OsLaMu_08g0024990 SBH 0.0 0.0 None
N22 | OsN22RS2 | Gramene(+IsoSeq) OsN22_12G009310 RBH 0.0 0.0 0.0
NATEL BORO | Os127652RS1 | Gramene(+IsoSeq) OsNaBo_12g0009190 RBH 0.0 4.773400 0.0
Powered by

© 2021- Rice Gene Index @Zhang Lab. All Rights Reserved.

National Key Laboratory of Crop Genetic Improvement

Huazhong Agricultural University

Any comments and suggestions, please contact us.