Basic Info

Gene ID OGI # | Score   Accession | Assembly | Annotation Location Links
OsLiXu_02g0001140 OGI:02003450 | 16/16 LIU XU | Os125827RS1 | Gramene(+IsoSeq) Chr02:858928-859137
Gene Symbol -
DNA seq

ttagcaggtcaaagtagccgccgcctcctgccattggagcagcagcagctgagctctgagctgctgctgcaatgcgccgtagctgccgctcatctggtccccgaacgcgccgccgtgcgacggcgtcacgttgccggagctcgccgtggacgccggccagtgctgcgccgagatggagtagctctcctgccccgccgccgccgcagacat

CDS seq

atgtctgcggcggcggcggggcaggagagctactccatctcggcgcagcactggccggcgtccacggcgagctccggcaacgtgacgccgtcgcacggcggcgcgttcggggaccagatgagcggcagctacggcgcattgcagcagcagctcagagctcagctgctgctgctccaatggcaggaggcggcggctactttgacctgctaa

Protein seq

MSAAAAGQESYSISAQHWPASTASSGNVTPSHGGAFGDQMSGSYGALQQQLRAQLLLLQWQEAAATLTC

Function -

Transcripts

Gene Transcript Chromosome Start End Strand Source
OsLiXu_02g0001140 OsLiXu_02g0001140.01 Chr02 858928 859137 - NAM
CDS seq

atgtctgcggcggcggcggggcaggagagctactccatctcggcgcagcactggccggcgtccacggcgagctccggcaacgtgacgccgtcgcacggcggcgcgttcggggaccagatgagcggcagctacggcgcattgcagcagcagctcagagctcagctgctgctgctccaatggcaggaggcggcggctactttgacctgctaa

More
Protein seq

MSAAAAGQESYSISAQHWPASTASSGNVTPSHGGAFGDQMSGSYGALQQQLRAQLLLLQWQEAAATLTC

Event Type Chromosome Start End Strand Alternative mRNAs Total mRNAs Source

Expression

Leaf Root Panicle
FPKM 0.000000 0.0 0.0

Homologues

Genome & Annotation Homologs Type Expression(FPKM)
Leaf Root Panicle
Nipponbare | IRGSP 1.0 | Gramene(+IsoSeq) OsNip_02g0114800 RBH 0.000000 0.000000 0.000000
Nipponbare | IRGSP 1.0 | MSU LOC_Os02g02370 RBH 0.000000 0.000000 0.000000
Nipponbare | IRGSP 1.0 | RAP-db Os02g0114800 RBH None None None
Azucena | AzucenaRS1 | Gramene(+IsoSeq) OsAzu_02g0001110 RBH 0.0 0.000000 0.0
KETAN NANGKA | Os128077RS1 | Gramene(+IsoSeq) OsKeNa_02g0001160 RBH 0.000000 9.443568 0.000000
CHAO MEO | Os132278RS1 | Gramene(+IsoSeq) OsCMeo_02g0001100 RBH 0.000000 5.422893 0.000000
ARC 10497 | Os117425RS1 | Gramene(+IsoSeq) NA NA NA NA NA
PR 106 | Os127742RS1 | Gramene(+IsoSeq) OsPr106_02g0001110 RBH 0.000000 12.625149 0.000000
Minghui 63 | MH63RS3 | HZAU OsMH63_02G0013300 RBH 0.048601 0.345563 0.126195
IR 64 | OsIR64RS1 | Gramene(+IsoSeq) OsIR64_02g0001100 RBH 0.000000 2.275510 0.000000
Zhenshan 97 | ZS97RS3 | HZAU OsZS97_02G0013800 RBH 0.0255905 0 0.3498145
LIMA | Os127564RS1 | Gramene(+IsoSeq) OsLima_02g0001120 RBH 0.000000 0.050214 None
KHAO YAI GUANG | Os127518RS1 | Gramene(+IsoSeq) OsKYG_02g0001070 RBH 0.000000 3.314209 None
GOBOL SAIL | Os132424RS1 | Gramene(+IsoSeq) OsGoSa_02g0001120 RBH 0.386800 33.652531 None
LIU XU | Os125827RS1 | Gramene(+IsoSeq) OsLiXu_Ung0006150 RBH 0.000000 0.0 0.000000
LARHA MUGAD | Os125619RS1 | Gramene(+IsoSeq) OsLaMu_02g0001150 SBH 0.000000 8.796266 None
N22 | OsN22RS2 | Gramene(+IsoSeq) OsN22_02G001120 RBH 0.000000 6.559485 0.291093
NATEL BORO | Os127652RS1 | Gramene(+IsoSeq) OsNaBo_02g0001090 RBH 0.000000 0.000000 0.0
Powered by

© 2021- Rice Gene Index @Zhang Lab. All Rights Reserved.

National Key Laboratory of Crop Genetic Improvement

Huazhong Agricultural University

Any comments and suggestions, please contact us.