Basic Info

Gene ID OGI # | Score   Accession | Assembly | Annotation Location Links
OsLaMu_11g0001000 OGI:12001350 | 16/16 LARHA MUGAD | Os125619RS1 | Gramene(+IsoSeq) Chr11:756735-756996
Gene Symbol OsRTPP1, RTPP1
DNA seq

ttagagaacaaattcaatgttataggcgttgaaaatgtaatacatggacttgtgcttgatcatccgaacctctcttggatcatctttaccacgggggcgcaccatctgcaggccagtgaaaacagcaaaatccgcagcaaaatcagagtgaatcatgtcatcatcagagtcgttgagtaaccaccagaagtgaagatcttaacggcgcaaaatctgccagagacgaggttgatgagcttcagctgaaacgtcaaccaggacc

CDS seq

atgattcactctgattttgctgcggattttgctgttttcactggcctgcagatggtgcgcccccgtggtaaagatgatccaagagaggttcggatgatcaagcacaagtccatgtattacattttcaacgcctataacattgaatttgttctctaa

Protein seq

MIHSDFAADFAVFTGLQMVRPRGKDDPREVRMIKHKSMYYIFNAYNIEFVL

Function -

Transcripts

Gene Transcript Chromosome Start End Strand Source
OsLaMu_11g0001000 OsLaMu_11g0001000.01 Chr11 756735 756996 - NAM
CDS seq

atgattcactctgattttgctgcggattttgctgttttcactggcctgcagatggtgcgcccccgtggtaaagatgatccaagagaggttcggatgatcaagcacaagtccatgtattacattttcaacgcctataacattgaatttgttctctaa

Protein seq

MIHSDFAADFAVFTGLQMVRPRGKDDPREVRMIKHKSMYYIFNAYNIEFVL

Event Type Chromosome Start End Strand Alternative mRNAs Total mRNAs Source

Expression

Leaf Root Panicle
FPKM 0.0 0.0 None

Homologues

Genome & Annotation Homologs Type Expression(FPKM)
Leaf Root Panicle
Nipponbare | IRGSP 1.0 | Gramene(+IsoSeq) OsNip_12g0109600 SBH 0.549033 2.037041 1.097040
Nipponbare | IRGSP 1.0 | MSU LOC_Os12g01880 SBH 0.371285 1.370080 0.282399
Nipponbare | IRGSP 1.0 | RAP-db Os12g0109600 SBH None None None
Azucena | AzucenaRS1 | Gramene(+IsoSeq) OsAzu_11g0000970 RBH 0.0 0.0 0.0
KETAN NANGKA | Os128077RS1 | Gramene(+IsoSeq) OsKeNa_11g0001020 RBH 0.0 0.0 0.0
CHAO MEO | Os132278RS1 | Gramene(+IsoSeq) OsCMeo_11g0000970 RBH 0.0 0.0 0.0
ARC 10497 | Os117425RS1 | Gramene(+IsoSeq) OsARC_11g0000980 RBH 0.0 0.0 None
PR 106 | Os127742RS1 | Gramene(+IsoSeq) OsPr106_11g0000970 RBH 0.0 0.0 0.0
Minghui 63 | MH63RS3 | HZAU OsMH63_11G0012500 SBH 0 0.008526 0
IR 64 | OsIR64RS1 | Gramene(+IsoSeq) OsIR64_11g0000970 RBH 0.0 0.0 0.0
Zhenshan 97 | ZS97RS3 | HZAU OsZS97_12G0008500 SBH 0 0 0
LIMA | Os127564RS1 | Gramene(+IsoSeq) OsLima_11g0000850 RBH 0.0 0.0 None
KHAO YAI GUANG | Os127518RS1 | Gramene(+IsoSeq) OsKYG_11g0000970 RBH 0.0 0.0 None
GOBOL SAIL | Os132424RS1 | Gramene(+IsoSeq) OsGoSa_11g0000970 RBH 0.0 0.0 None
LIU XU | Os125827RS1 | Gramene(+IsoSeq) OsLiXu_11g0000970 RBH 0.0 0.0 0.0
LARHA MUGAD | Os125619RS1 | Gramene(+IsoSeq) OsLaMu_12g0000710 RBH 0.072880 0.830458 None
N22 | OsN22RS2 | Gramene(+IsoSeq) OsN22_11G000980 RBH 0.0 0.0 0.0
NATEL BORO | Os127652RS1 | Gramene(+IsoSeq) OsNaBo_11g0000960 RBH 0.0 0.0 0.0
Powered by

© 2021- Rice Gene Index @Zhang Lab. All Rights Reserved.

National Key Laboratory of Crop Genetic Improvement

Huazhong Agricultural University

Any comments and suggestions, please contact us.