Basic Info

Gene ID OGI # | Score   Accession | Assembly | Annotation Location Links
OsLaMu_06g0017810 OGI:06054070 | 4/16 LARHA MUGAD | Os125619RS1 | Gramene(+IsoSeq) Chr06:21039690-21040406
Gene Symbol -
DNA seq

atggagcagttccacgacagggaccacgagcggctgcggagccgcgtgcacggcacgtacctccacgccgatgaggacgggaggggcgtctccctgcagccgaccggggcatcgctcaccgcggtttggacggtgcacctggagggcggtagcccccagcgccgcctcctgctccaaagcgccgcctacggccgataccttgcggccacaggcaagccggcgccgagcggcctccgtggccaccgtgtcgcgcttatcaacctcgaccagctggacgacgagtccgtgtcgtgggaggcggttcggacggcgaaaggagatgacgtgctgctccggcacgccgcggggcgcaacctacgcgccaaccacggcgctggcgccaccgttgatgatagatacagcaggatgctgctctgggtggaccaggtggttgaggccatcccctcggcagattccgtacccaggcctccaccgatctcaagggtgagcatgctacaccctcttccatggtacatcctgaattggttgggggcaggggagcgattctttagcccattactgcgttacctaggttcttgcagccaagctccatttctggttgtattcttgcgtcagagttagcgcattagcagagtttcatcaattgcattgttcttgatgaaatccttgttgtgttcttgctagatttcgtcctttgttgttaatcatttgcaatga

More
CDS seq

atggagcagttccacgacagggaccacgagcggctgcggagccgcgtgcacggcacgtacctccacgccgatgaggacgggaggggcgtctccctgcagccgaccggggcatcgctcaccgcggtttggacggtgcacctggagggcggtagcccccagcgccgcctcctgctccaaagcgccgcctacggccgataccttgcggccacaggcaagccggcgccgagcggcctccgtggccaccgtgtcgcgcttatcaacctcgaccagctggacgacgagtccgtgtcgtgggaggcggttcggacggcgaaaggagatgacgtgctgctccggcacgccgcggggcgcaacctacgcgccaaccacggcgctggcgccaccgttgatgatagatacagcaggatgctgctctgggtggaccaggtggttgaggccatcccctcggcagattccgtacccaggcctccaccgatctcaaggatttcgtcctttgttgttaatcatttgcaatga

More
Protein seq

MEQFHDRDHERLRSRVHGTYLHADEDGRGVSLQPTGASLTAVWTVHLEGGSPQRRLLLQSAAYGRYLAATGKPAPSGLRGHRVALINLDQLDDESVSWEAVRTAKGDDVLLRHAAGRNLRANHGAGATVDDRYSRMLLWVDQVVEAIPSADSVPRPPPISRISSFVVNHLQ

Function -

Transcripts

Gene Transcript Chromosome Start End Strand Source
OsLaMu_06g0017810 OsLaMu_06g0017810.01 Chr06 21039690 21040406 + NAM
CDS seq

atggagcagttccacgacagggaccacgagcggctgcggagccgcgtgcacggcacgtacctccacgccgatgaggacgggaggggcgtctccctgcagccgaccggggcatcgctcaccgcggtttggacggtgcacctggagggcggtagcccccagcgccgcctcctgctccaaagcgccgcctacggccgataccttgcggccacaggcaagccggcgccgagcggcctccgtggccaccgtgtcgcgcttatcaacctcgaccagctggacgacgagtccgtgtcgtgggaggcggttcggacggcgaaaggagatgacgtgctgctccggcacgccgcggggcgcaacctacgcgccaaccacggcgctggcgccaccgttgatgatagatacagcaggatgctgctctgggtggaccaggtggttgaggccatcccctcggcagattccgtacccaggcctccaccgatctcaaggatttcgtcctttgttgttaatcatttgcaatga

More
Protein seq

MEQFHDRDHERLRSRVHGTYLHADEDGRGVSLQPTGASLTAVWTVHLEGGSPQRRLLLQSAAYGRYLAATGKPAPSGLRGHRVALINLDQLDDESVSWEAVRTAKGDDVLLRHAAGRNLRANHGAGATVDDRYSRMLLWVDQVVEAIPSADSVPRPPPISRISSFVVNHLQ

Event Type Chromosome Start End Strand Alternative mRNAs Total mRNAs Source

Expression

Leaf Root Panicle
FPKM 0.0 0.0 None

Homologues

Genome & Annotation Homologs Type Expression(FPKM)
Leaf Root Panicle
Nipponbare | IRGSP 1.0 | Gramene(+IsoSeq) OsNip_06g0161100 SBH 0.0 0.0 0.0
Nipponbare | IRGSP 1.0 | MSU LOC_Os06g06580 SBH 0.0 0.0 0.0
Nipponbare | IRGSP 1.0 | RAP-db Os06g0161100 SBH None None None
Azucena | AzucenaRS1 | Gramene(+IsoSeq) OsAzu_06g0004490 SBH 0.0 0.0 0.0
KETAN NANGKA | Os128077RS1 | Gramene(+IsoSeq) OsKeNa_06g0004400 SBH 0.0 0.0 0.0
CHAO MEO | Os132278RS1 | Gramene(+IsoSeq) OsCMeo_06g0004340 SBH 0.0 0.0 0.0
ARC 10497 | Os117425RS1 | Gramene(+IsoSeq) OsARC_06g0004450 SBH 0.0 0.0 None
PR 106 | Os127742RS1 | Gramene(+IsoSeq) OsPr106_06g0018140 SBH 0.000000 0.000000 0.000000
Minghui 63 | MH63RS3 | HZAU OsMH63_06G0305600 RBH 0 0 0
IR 64 | OsIR64RS1 | Gramene(+IsoSeq) OsIR64_06g0017620 SBH 0.000000 0.000000 0.036977
Zhenshan 97 | ZS97RS3 | HZAU OsZS97_06G0279900 SBH 0.152919 0 0.5559825
LIMA | Os127564RS1 | Gramene(+IsoSeq) OsLima_06g0018030 RBH 0.0 0.0 None
KHAO YAI GUANG | Os127518RS1 | Gramene(+IsoSeq) OsKYG_06g0017990 SBH 0.0 0.0 None
GOBOL SAIL | Os132424RS1 | Gramene(+IsoSeq) OsGoSa_06g0017660 RBH 0.0 0.0 None
LIU XU | Os125827RS1 | Gramene(+IsoSeq) OsLiXu_06g0018340 SBH 0.000000 0.0 0.000000
LARHA MUGAD | Os125619RS1 | Gramene(+IsoSeq) OsLaMu_06g0004240 SBH 0.0 0.0 None
N22 | OsN22RS2 | Gramene(+IsoSeq) OsN22_06G017770 SBH 0.0 0.0 0.0
NATEL BORO | Os127652RS1 | Gramene(+IsoSeq) OsNaBo_06g0017920 SBH 0.0 0.0 0.0
Powered by

© 2021- Rice Gene Index @Zhang Lab. All Rights Reserved.

National Key Laboratory of Crop Genetic Improvement

Huazhong Agricultural University

Any comments and suggestions, please contact us.