Basic Info

Gene ID OGI # | Score   Accession | Assembly | Annotation Location Links
OsKeNa_10g0012870 OGI:10051600 | 16/16 KETAN NANGKA | Os128077RS1 | Gramene(+IsoSeq) Chr10:18539472-18539825
Gene Symbol -
DNA seq

atgccggagaacgcgttcgtgatggtgcaggaagggacgctgtgcctggcgatcgtggcgataacggagcagcagccggtgtccatcctcgggaacctcgcgcagcagaacatccacgtcggccacgacctcgacgccggcacggtcaccttcgccaccgccgactgcgcggggagcggccggccggcggagcagacgagcggcgggcaggcgcgccgcaggagaggaagatggcgccgacggggatcgggacggggagagcgaggacgtcgccgccgtcgtcgtccatggccgcagatctttcgtccgcgccgtcagcggcgtcgccggcgggtgtgtgtgagcgcggggtag

CDS seq

atgccggagaacgcgttcgtgatggtgcaggaagggacgctgtgcctggcgatcgtggcgataacggagcagcagccggtgtccatcctcgggaacctcgcgcagcagaacatccacgtcggccacgacctcgacgccggcacggtcaccttcgccaccgccgactgcgcggggagcggccggccggcggagcagacgagcggcgggcaggcgcgccgcaggagaggaagatggcgccgacggggatcgggacggggagagcgaggacgtcgccgccgtcgtcgtccatggccgcagatctttcgtccgcgccgtcagcggcgtcgccggcgggtgtgtgtgagcgcggggtag

Protein seq

MPENAFVMVQEGTLCLAIVAITEQQPVSILGNLAQQNIHVGHDLDAGTVTFATADCAGSGRPAEQTSGGQARRRRGRWRRRGSGRGERGRRRRRRPWPQIFRPRRQRRRRRVCVSAG

Function -

Transcripts

Gene Transcript Chromosome Start End Strand Source
OsKeNa_10g0012870 OsKeNa_10g0012870.01 Chr10 18539472 18539825 + NAM
CDS seq

atgccggagaacgcgttcgtgatggtgcaggaagggacgctgtgcctggcgatcgtggcgataacggagcagcagccggtgtccatcctcgggaacctcgcgcagcagaacatccacgtcggccacgacctcgacgccggcacggtcaccttcgccaccgccgactgcgcggggagcggccggccggcggagcagacgagcggcgggcaggcgcgccgcaggagaggaagatggcgccgacggggatcgggacggggagagcgaggacgtcgccgccgtcgtcgtccatggccgcagatctttcgtccgcgccgtcagcggcgtcgccggcgggtgtgtgtgagcgcggggtag

More
Protein seq

MPENAFVMVQEGTLCLAIVAITEQQPVSILGNLAQQNIHVGHDLDAGTVTFATADCAGSGRPAEQTSGGQARRRRGRWRRRGSGRGERGRRRRRRPWPQIFRPRRQRRRRRVCVSAG

Event Type Chromosome Start End Strand Alternative mRNAs Total mRNAs Source

Expression

Leaf Root Panicle
FPKM 0.100938 0.0 0.0

Homologues

Genome & Annotation Homologs Type Expression(FPKM)
Leaf Root Panicle
Nipponbare | IRGSP 1.0 | Gramene(+IsoSeq) OsNip_10g0538200 SBH 0.0 0.0 0.0
Nipponbare | IRGSP 1.0 | MSU LOC_Os10g39310 SBH 0.0 0.0 0.0
Nipponbare | IRGSP 1.0 | RAP-db Os10g0538200 SBH None None None
Azucena | AzucenaRS1 | Gramene(+IsoSeq) OsAzu_10g0012670 RBH 0.0 0.0 0.237290
KETAN NANGKA | Os128077RS1 | Gramene(+IsoSeq) NA NA NA NA NA
CHAO MEO | Os132278RS1 | Gramene(+IsoSeq) OsCMeo_10g0012560 RBH 0.0 1.647838 0.0
ARC 10497 | Os117425RS1 | Gramene(+IsoSeq) OsARC_10g0012830 RBH 0.0 0.0 None
PR 106 | Os127742RS1 | Gramene(+IsoSeq) OsPr106_10g0012570 RBH 0.0 0.0 0.0
Minghui 63 | MH63RS3 | HZAU OsMH63_10G0268700 RBH 0.014653 0.0111815 0.0499795
IR 64 | OsIR64RS1 | Gramene(+IsoSeq) OsIR64_10g0012600 RBH 0.000000 0.0 0.0
Zhenshan 97 | ZS97RS3 | HZAU OsZS97_10G0370800 SBH 0.4132875 62.9046805 0.0287445
LIMA | Os127564RS1 | Gramene(+IsoSeq) OsLima_10g0012340 RBH 0.0 0.0 None
KHAO YAI GUANG | Os127518RS1 | Gramene(+IsoSeq) OsKYG_10g0012330 RBH 0.0 0.0 None
GOBOL SAIL | Os132424RS1 | Gramene(+IsoSeq) OsGoSa_10g0012730 RBH 0.0 0.0 None
LIU XU | Os125827RS1 | Gramene(+IsoSeq) OsLiXu_10g0012340 RBH 0.0 0.0 0.0
LARHA MUGAD | Os125619RS1 | Gramene(+IsoSeq) OsLaMu_10g0012840 RBH 0.000000 0.0 None
N22 | OsN22RS2 | Gramene(+IsoSeq) OsN22_10G012690 RBH 0.0 0.0 0.0
NATEL BORO | Os127652RS1 | Gramene(+IsoSeq) OsNaBo_10g0012640 RBH 0.000000 0.000000 0.000000
Powered by

© 2021- Rice Gene Index @Zhang Lab. All Rights Reserved.

National Key Laboratory of Crop Genetic Improvement

Huazhong Agricultural University

Any comments and suggestions, please contact us.