Basic Info

Gene ID OGI # | Score   Accession | Assembly | Annotation Location Links
OsKeNa_04g0012290 OGI:04061300 | 13/16 KETAN NANGKA | Os128077RS1 | Gramene(+IsoSeq) Chr04:17895531-17895947
Gene Symbol C3H29, OsC3H29, OsCCCH-Zn-9
DNA seq

atggagcactccaaggaattcatcgacgagctccacaagcccttgacggcagaagagaaggcgcagatggtggcagacgggaaggagaaggttcagcttcaagaaaaacaagaggagctgacggcagaggcgaaggcgcgtatggtggcagacgggaagaagaaggttcagcttcaggagaaacaagaggaggacggcactgcgcttcgtcaggggagtcgtctttcggctaccgacctcatccggtacaccctcatgggcatccggtttgcgttcacggcggcgatgcactactaccactgtacacagatgcagatgatgcccgagcttacaagaactacttttggcgtgttttacaattgttttcactattttttcattgctatcattattctagctagctatatgggtatttag

More
CDS seq

atggagcactccaaggaattcatcgacgagctccacaagcccttgacggcagaagagaaggcgcagatggtggcagacgggaaggagaaggttcagcttcaagaaaaacaagaggagctgacggcagaggcgaaggcgcgtatggtggcagacgggaagaagaaggttcagcttcaggagaaacaagaggaggacggcactgcgcttcgtcaggggagtcgtctttcggctaccgacctcatccggtacaccctcatgggcatccggtttgcgttcacggcggcgatgcactactaccactgtacacagatgcagatgatgcccgagcttacaagaactacttttggcgtgttttacaattgttttcactattttttcattgctatcattattctagctagctatatgggtatttag

More
Protein seq

MEHSKEFIDELHKPLTAEEKAQMVADGKEKVQLQEKQEELTAEAKARMVADGKKKVQLQEKQEEDGTALRQGSRLSATDLIRYTLMGIRFAFTAAMHYYHCTQMQMMPELTRTTFGVFYNCFHYFFIAIIILASYMGI

Function -

Transcripts

Gene Transcript Chromosome Start End Strand Source
OsKeNa_04g0012290 OsKeNa_04g0012290.01 Chr04 17895531 17895947 + NAM
CDS seq

atggagcactccaaggaattcatcgacgagctccacaagcccttgacggcagaagagaaggcgcagatggtggcagacgggaaggagaaggttcagcttcaagaaaaacaagaggagctgacggcagaggcgaaggcgcgtatggtggcagacgggaagaagaaggttcagcttcaggagaaacaagaggaggacggcactgcgcttcgtcaggggagtcgtctttcggctaccgacctcatccggtacaccctcatgggcatccggtttgcgttcacggcggcgatgcactactaccactgtacacagatgcagatgatgcccgagcttacaagaactacttttggcgtgttttacaattgttttcactattttttcattgctatcattattctagctagctatatgggtatttag

More
Protein seq

MEHSKEFIDELHKPLTAEEKAQMVADGKEKVQLQEKQEELTAEAKARMVADGKKKVQLQEKQEEDGTALRQGSRLSATDLIRYTLMGIRFAFTAAMHYYHCTQMQMMPELTRTTFGVFYNCFHYFFIAIIILASYMGI

Event Type Chromosome Start End Strand Alternative mRNAs Total mRNAs Source

Expression

Leaf Root Panicle
FPKM 0.0 0.0 0.0

Homologues

Genome & Annotation Homologs Type Expression(FPKM)
Leaf Root Panicle
Nipponbare | IRGSP 1.0 | Gramene(+IsoSeq) OsNip_04g0487550 SBH 0.0 0.0 0.0
Nipponbare | IRGSP 1.0 | MSU LOC_Os04g32200 RBH 0.0 0.0 0.0
Nipponbare | IRGSP 1.0 | RAP-db Os04g0487550 SBH None None None
Azucena | AzucenaRS1 | Gramene(+IsoSeq) OsAzu_04g0011500 RBH 0.0 0.0 0.0
KETAN NANGKA | Os128077RS1 | Gramene(+IsoSeq) OsKeNa_04g0012260 RBH 0.0 0.0 0.0
CHAO MEO | Os132278RS1 | Gramene(+IsoSeq) OsCMeo_04g0011980 RBH 0.0 0.0 2.381647
ARC 10497 | Os117425RS1 | Gramene(+IsoSeq) OsARC_04g0011650 RBH 0.0 0.0 None
PR 106 | Os127742RS1 | Gramene(+IsoSeq) OsPr106_04g0011890 RBH 0.0 0.0 0.0
Minghui 63 | MH63RS3 | HZAU OsMH63_04G0306900 SBH 0 0 0.0460475
IR 64 | OsIR64RS1 | Gramene(+IsoSeq) OsIR64_04g0010800 RBH 0.0 0.0 0.0
Zhenshan 97 | ZS97RS3 | HZAU OsZS97_04G0303500 SBH 0 0.011122 0.047633
LIMA | Os127564RS1 | Gramene(+IsoSeq) OsLima_04g0011450 RBH 0.0 0.0 None
KHAO YAI GUANG | Os127518RS1 | Gramene(+IsoSeq) OsKYG_04g0011050 RBH 0.0 0.0 None
GOBOL SAIL | Os132424RS1 | Gramene(+IsoSeq) OsGoSa_04g0011070 RBH 0.0 0.0 None
LIU XU | Os125827RS1 | Gramene(+IsoSeq) OsLiXu_04g0011560 SBH 0.0 0.0 0.0
LARHA MUGAD | Os125619RS1 | Gramene(+IsoSeq) OsLaMu_04g0011810 RBH 0.0 0.0 None
N22 | OsN22RS2 | Gramene(+IsoSeq) OsN22_04G010980 RBH 0.0 0.0 0.0
NATEL BORO | Os127652RS1 | Gramene(+IsoSeq) OsNaBo_04g0011010 RBH 0.0 0.0 0.0
Powered by

© 2021- Rice Gene Index @Zhang Lab. All Rights Reserved.

National Key Laboratory of Crop Genetic Improvement

Huazhong Agricultural University

Any comments and suggestions, please contact us.