Basic Info

Gene ID OGI # | Score   Accession | Assembly | Annotation Location Links
OsGoSa_11g0019890 OGI:11068270 | 9/16 GOBOL SAIL | Os132424RS1 | Gramene(+IsoSeq) Chr11:26339551-26339924
Gene Symbol -
DNA seq

atggtgattgaaggcaaggtgttcggaggtctttagaggttctcccttgattgccctgttccatggctaacttttaaagaagggaccatgccgatacttgagtacctgcaactaaatatttgctcagtcccaatgaatcaagtgaacgcttttccattgggccttgccaatctccggagcatcacggattcacggaggtagtcatctattatagtgaacggtgtggcaatagctcaagcatcaagatgacagtcgatgcagttagacaataggtcgccaggcatcctgacggcctgatcaaccttgtcatcaatggcaaacaagaagacattgaagcattggacgaggcctgtgggggcagagagggcaactga

CDS seq

atggtgattgaaggcaagaggttctcccttgattgccctgttccatggctaacttttaaagaagggaccatgccgatacttgagtacctgcaactaaatatttgctcagtcccaatgaatcaagtgaacgcttttccattgggccttgccaatctccggagcatcacggattcacggaggcatcctgacggcctgatcaaccttgtcatcaatggcaaacaagaagacattgaagcattggacgaggcctgtgggggcagagagggcaactga

Protein seq

MVIEGKRFSLDCPVPWLTFKEGTMPILEYLQLNICSVPMNQVNAFPLGLANLRSITDSRRHPDGLINLVINGKQEDIEALDEACGGREGN

Function -

Transcripts

Gene Transcript Chromosome Start End Strand Source
OsGoSa_11g0019890 OsGoSa_11g0019890.01 Chr11 26339551 26339924 + NAM
CDS seq

atggtgattgaaggcaagaggttctcccttgattgccctgttccatggctaacttttaaagaagggaccatgccgatacttgagtacctgcaactaaatatttgctcagtcccaatgaatcaagtgaacgcttttccattgggccttgccaatctccggagcatcacggattcacggaggcatcctgacggcctgatcaaccttgtcatcaatggcaaacaagaagacattgaagcattggacgaggcctgtgggggcagagagggcaactga

More
Protein seq

MVIEGKRFSLDCPVPWLTFKEGTMPILEYLQLNICSVPMNQVNAFPLGLANLRSITDSRRHPDGLINLVINGKQEDIEALDEACGGREGN

Event Type Chromosome Start End Strand Alternative mRNAs Total mRNAs Source

Expression

Leaf Root Panicle
FPKM 0.0 0.0 None

Homologues

Genome & Annotation Homologs Type Expression(FPKM)
Leaf Root Panicle
Nipponbare | IRGSP 1.0 | Gramene(+IsoSeq) OsNip_11g0605100 SBH 3.138117 2.327258 0.000000
Nipponbare | IRGSP 1.0 | MSU LOC_Os11g39310 SBH 1.635008 0.758533 0.042027
Nipponbare | IRGSP 1.0 | RAP-db Os11g0605100 SBH None None None
Azucena | AzucenaRS1 | Gramene(+IsoSeq) OsAzu_11g0019960 RBH 0.0 0.000000 0.0
KETAN NANGKA | Os128077RS1 | Gramene(+IsoSeq) OsKeNa_11g0020110 RBH 0.0 0.0 0.0
CHAO MEO | Os132278RS1 | Gramene(+IsoSeq) OsCMeo_11g0019880 RBH 0.0 0.0 0.0
ARC 10497 | Os117425RS1 | Gramene(+IsoSeq) OsARC_11g0019270 SBH 0.0 0.0 None
PR 106 | Os127742RS1 | Gramene(+IsoSeq) OsPr106_11g0019810 SBH 0.0 7.217703 0.000000
Minghui 63 | MH63RS3 | HZAU OsMH63_11G0358900 SBH 1.2529555 7.7204685 0.67106
IR 64 | OsIR64RS1 | Gramene(+IsoSeq) OsIR64_11g0020420 RBH 0.0 0.0 0.0
Zhenshan 97 | ZS97RS3 | HZAU OsZS97_11G0374400 SBH 1.6029655 17.47533 0.5658625
LIMA | Os127564RS1 | Gramene(+IsoSeq) OsLima_11g0020260 SBH 0.099495 0.394560 None
KHAO YAI GUANG | Os127518RS1 | Gramene(+IsoSeq) OsKYG_11g0020280 SBH 0.0 0.0 None
GOBOL SAIL | Os132424RS1 | Gramene(+IsoSeq) OsGoSa_11g0019920 SBH 3.438088 18.709637 None
LIU XU | Os125827RS1 | Gramene(+IsoSeq) OsLiXu_11g0019700 RBH 0.0 0.0 0.0
LARHA MUGAD | Os125619RS1 | Gramene(+IsoSeq) OsLaMu_11g0019810 RBH 0.0 0.0 None
N22 | OsN22RS2 | Gramene(+IsoSeq) OsN22_11G019740 RBH 0.000000 0.000000 0.000000
NATEL BORO | Os127652RS1 | Gramene(+IsoSeq) OsNaBo_11g0020130 RBH 0.0 0.0 0.0
Powered by

© 2021- Rice Gene Index @Zhang Lab. All Rights Reserved.

National Key Laboratory of Crop Genetic Improvement

Huazhong Agricultural University

Any comments and suggestions, please contact us.