Basic Info

Gene ID OGI # | Score   Accession | Assembly | Annotation Location Links
OsCMeo_09g0010480 OGI:09043620 | 15/16 CHAO MEO | Os132278RS1 | Gramene(+IsoSeq) Chr09:14857699-14858417
Gene Symbol -
DNA seq

attgctgcaaagcttggtgccgagtgagagagcagcaaagcgagagtgtgcgtgcgtgggcgtgtcgcgccatgatgaagaggctggtggtcctgaggaggcgggagccggcggtgaggttcagctgctgcggcgtcaggtacggcgagtgccgccgcaaccacgcggccagcaccggcggccacgccgtcgacggctgccgcgagttcatcgccgccgaggacggcggcggcggcaacagcacaagcgccgtgggcgtcgccgcggcggcgctcaagtgcgccgcctgcggctgccaccgcagcttccaccgcagggtgcaggtgtacgaggtggcctgggacgacgactgcgcctccggcgacacctcctcctcctcgccgtcgtcgtcgtcctcgttgagcagcgagtagaccagctgcggcaatggcggcggcgcgccgccgccgcagctgccgtctccggccggtgcatcgtcatgctgcatgcctaggatatgatcagacctcgcgattgttaattaattaattaattaattaattattagcttgtgtaatctgtatacccatggattgattgaccctattccccccaagtgattatttgctctcatctctaattaatcaattaattaatgccttattttaacttttttcccctgaatctctgatccaatccatatctgatcttcaacaagccggcttgattattgcattgtc

More
CDS seq

atgatgaagaggctggtggtcctgaggaggcgggagccggcggtgaggttcagctgctgcggcgtcaggtacggcgagtgccgccgcaaccacgcggccagcaccggcggccacgccgtcgacggctgccgcgagttcatcgccgccgaggacggcggcggcggcaacagcacaagcgccgtgggcgtcgccgcggcggcgctcaagtgcgccgcctgcggctgccaccgcagcttccaccgcagggtgcaggtgtacgaggtggcctgggacgacgactgcgcctccggcgacacctcctcctcctcgccgtcgtcgtcgtcctcgttgagcagcgagtag

Protein seq

MMKRLVVLRRREPAVRFSCCGVRYGECRRNHAASTGGHAVDGCREFIAAEDGGGGNSTSAVGVAAAALKCAACGCHRSFHRRVQVYEVAWDDDCASGDTSSSSPSSSSSLSSE

Function Mini zinc finger protein 2 [UniProtKB/Swiss-Prot:Q6ER22]

Transcripts

Gene Transcript Chromosome Start End Strand Source
OsCMeo_09g0010480 OsCMeo_09g0010480.01 Chr09 14857699 14858417 + NAM
CDS seq

atgatgaagaggctggtggtcctgaggaggcgggagccggcggtgaggttcagctgctgcggcgtcaggtacggcgagtgccgccgcaaccacgcggccagcaccggcggccacgccgtcgacggctgccgcgagttcatcgccgccgaggacggcggcggcggcaacagcacaagcgccgtgggcgtcgccgcggcggcgctcaagtgcgccgcctgcggctgccaccgcagcttccaccgcagggtgcaggtgtacgaggtggcctgggacgacgactgcgcctccggcgacacctcctcctcctcgccgtcgtcgtcgtcctcgttgagcagcgagtag

More
Protein seq

MMKRLVVLRRREPAVRFSCCGVRYGECRRNHAASTGGHAVDGCREFIAAEDGGGGNSTSAVGVAAAALKCAACGCHRSFHRRVQVYEVAWDDDCASGDTSSSSPSSSSSLSSE

Event Type Chromosome Start End Strand Alternative mRNAs Total mRNAs Source

Expression

Leaf Root Panicle
FPKM 0.0 0.0 0.0

Homologues

Genome & Annotation Homologs Type Expression(FPKM)
Leaf Root Panicle
Nipponbare | IRGSP 1.0 | Gramene(+IsoSeq) OsNip_09g0414500 RBH 0.0 0.0 0.0
Nipponbare | IRGSP 1.0 | MSU LOC_Os09g24810 RBH 0.0 0.0 0.0
Nipponbare | IRGSP 1.0 | RAP-db Os09g0414500 RBH None None None
Azucena | AzucenaRS1 | Gramene(+IsoSeq) OsAzu_09g0010230 RBH 0.0 0.0 0.0
KETAN NANGKA | Os128077RS1 | Gramene(+IsoSeq) OsKeNa_09g0010180 RBH 0.0 0.0 0.443729
CHAO MEO | Os132278RS1 | Gramene(+IsoSeq) OsCMeo_08g0017160 RBH 0.0 0.0 0.0
ARC 10497 | Os117425RS1 | Gramene(+IsoSeq) OsARC_09g0010240 RBH 0.0 0.082040 None
PR 106 | Os127742RS1 | Gramene(+IsoSeq) OsPr106_09g0010350 RBH 0.0 0.0 0.0
Minghui 63 | MH63RS3 | HZAU OsMH63_09G0296200 SBH 2.8584855 0.0188195 7.0523605
IR 64 | OsIR64RS1 | Gramene(+IsoSeq) OsIR64_09g0010330 RBH 0.0 0.0 0.0
Zhenshan 97 | ZS97RS3 | HZAU OsZS97_09G0235600 RBH 3.2368085 0 1.00811
LIMA | Os127564RS1 | Gramene(+IsoSeq) OsLima_09g0010310 RBH 0.0 0.0 None
KHAO YAI GUANG | Os127518RS1 | Gramene(+IsoSeq) OsKYG_09g0010080 RBH 0.0 0.0 None
GOBOL SAIL | Os132424RS1 | Gramene(+IsoSeq) OsGoSa_09g0010240 RBH 0.0 0.0 None
LIU XU | Os125827RS1 | Gramene(+IsoSeq) OsLiXu_09g0010040 RBH 0.0 0.0 0.0
LARHA MUGAD | Os125619RS1 | Gramene(+IsoSeq) OsLaMu_09g0010110 RBH 0.0 0.0 None
N22 | OsN22RS2 | Gramene(+IsoSeq) OsN22_09G010580 RBH 0.0 0.0 0.738650
NATEL BORO | Os127652RS1 | Gramene(+IsoSeq) OsNaBo_09g0010370 RBH 0.0 0.0 0.0
Powered by

© 2021- Rice Gene Index @Zhang Lab. All Rights Reserved.

National Key Laboratory of Crop Genetic Improvement

Huazhong Agricultural University

Any comments and suggestions, please contact us.