Basic Info

Gene ID OGI # | Score   Accession | Assembly | Annotation Location Links
OsARC_06g0019340 OGI:06059800 | 16/16 ARC 10497 | Os117425RS1 | Gramene(+IsoSeq) Chr06:22255017-22255382
Gene Symbol SCP37, OsSCP37
DNA seq

tcagcctgcgcgcttcatgccgccgtggcggccgaatagccccgcctgcaacacccaatccttcaccatctcctgcgccgcgtggccgttgtcagccggcaagaggtgcccggcgccgtagacgacgacgtgggagaacgggccggagcgctgcacatacccggcgagctcctcgccgatgcgccacacggcgcagtcggcgtcgaggaagacggccaggccgtcccacttcagctcccgcatccacgcctccgtggacaccacgccgtccctgaggtcgcggatgccctggtacagcagcacgcgcgttccccgcagcagcgcctccaccttcggcttcacgctcttcatcacgtccccgtgcat

CDS seq

atgcacggggacgtgatgaagagcgtgaagccgaaggtggaggcgctgctgcggggaacgcgcgtgctgctgtaccagggcatccgcgacctcagggacggcgtggtgtccacggaggcgtggatgcgggagctgaagtgggacggcctggccgtcttcctcgacgccgactgcgccgtgtggcgcatcggcgaggagctcgccgggtatgtgcagcgctccggcccgttctcccacgtcgtcgtctacggcgccgggcacctcttgccggctgacaacggccacgcggcgcaggagatggtgaaggattgggtgttgcaggcggggctattcggccgccacggcggcatgaagcgcgcaggctga

Protein seq

MHGDVMKSVKPKVEALLRGTRVLLYQGIRDLRDGVVSTEAWMRELKWDGLAVFLDADCAVWRIGEELAGYVQRSGPFSHVVVYGAGHLLPADNGHAAQEMVKDWVLQAGLFGRHGGMKRAG

Function Serine carboxypeptidase-like 50 [UniProtKB/Swiss-Prot:Q9M9Q6]

Transcripts

Gene Transcript Chromosome Start End Strand Source
OsARC_06g0019340 OsARC_06g0019340.01 Chr06 22255017 22255382 - NAM
CDS seq

atgcacggggacgtgatgaagagcgtgaagccgaaggtggaggcgctgctgcggggaacgcgcgtgctgctgtaccagggcatccgcgacctcagggacggcgtggtgtccacggaggcgtggatgcgggagctgaagtgggacggcctggccgtcttcctcgacgccgactgcgccgtgtggcgcatcggcgaggagctcgccgggtatgtgcagcgctccggcccgttctcccacgtcgtcgtctacggcgccgggcacctcttgccggctgacaacggccacgcggcgcaggagatggtgaaggattgggtgttgcaggcggggctattcggccgccacggcggcatgaagcgcgcaggctga

More
Protein seq

MHGDVMKSVKPKVEALLRGTRVLLYQGIRDLRDGVVSTEAWMRELKWDGLAVFLDADCAVWRIGEELAGYVQRSGPFSHVVVYGAGHLLPADNGHAAQEMVKDWVLQAGLFGRHGGMKRAG

No AS event found.

Event Type Chromosome Start End Strand Alternative mRNAs Total mRNAs Source

Expression

Leaf Root Panicle
FPKM 0.0 0.0 None

Homologues

Genome & Annotation Homologs Type Expression(FPKM)
Leaf Root Panicle
Nipponbare | IRGSP 1.0 | Gramene(+IsoSeq) OsNip_06g0561100 RBH 0.0 0.0 1.473375
Nipponbare | IRGSP 1.0 | MSU LOC_Os06g36570 RBH 0.0 0.0 0.203183
Nipponbare | IRGSP 1.0 | RAP-db Os06g0561100 RBH None None None
Azucena | AzucenaRS1 | Gramene(+IsoSeq) OsAzu_06g0019620 RBH 0.0 0.0 0.0
KETAN NANGKA | Os128077RS1 | Gramene(+IsoSeq) OsKeNa_06g0019500 RBH 0.0 0.0 0.0
CHAO MEO | Os132278RS1 | Gramene(+IsoSeq) OsCMeo_06g0019560 RBH 0.0 0.0 0.357276
ARC 10497 | Os117425RS1 | Gramene(+IsoSeq) OsARC_05g0028310 SBH 0.139312 0.106191 None
PR 106 | Os127742RS1 | Gramene(+IsoSeq) OsPr106_06g0019750 RBH 0.0 0.0 0.0
Minghui 63 | MH63RS3 | HZAU OsMH63_06G0339300 RBH 0.0338555 0.1439815 0
IR 64 | OsIR64RS1 | Gramene(+IsoSeq) OsIR64_06g0019230 RBH 0.0 0.0 0.0
Zhenshan 97 | ZS97RS3 | HZAU OsZS97_06G0313500 RBH 0.034003 0.087583 0.174707
LIMA | Os127564RS1 | Gramene(+IsoSeq) OsLima_06g0019680 RBH 0.0 0.0 None
KHAO YAI GUANG | Os127518RS1 | Gramene(+IsoSeq) OsKYG_06g0019650 RBH 0.0 0.0 None
GOBOL SAIL | Os132424RS1 | Gramene(+IsoSeq) OsGoSa_06g0019300 RBH 0.0 0.0 None
LIU XU | Os125827RS1 | Gramene(+IsoSeq) OsLiXu_06g0019990 RBH 0.0 0.0 0.0
LARHA MUGAD | Os125619RS1 | Gramene(+IsoSeq) OsLaMu_06g0019460 RBH 0.0 0.000000 None
N22 | OsN22RS2 | Gramene(+IsoSeq) OsN22_06G019340 RBH 0.0 0.0 0.0
NATEL BORO | Os127652RS1 | Gramene(+IsoSeq) OsNaBo_06g0019520 RBH 0.0 0.0 0.0
Powered by

© 2021-2025 Rice Gene Index @Zhang Lab. All Rights Reserved.

National Key Laboratory of Crop Genetic Improvement

Huazhong Agricultural University

Any comments and suggestions, please contact us.