Basic Info

Gene ID OGI # | Score   Accession | Assembly | Annotation Location Links
OsNaBo_03g0010220 OGI:03020300 | 16/16 NATEL BORO | Os127652RS1 | Gramene(+IsoSeq) Chr03:7766396-7766773
Gene Symbol -
DNA seq

atggggctgctccgctgccgaaagagctgctgcctccactggatgaactacctcagccccgacctcaagtgcagcaacttcaccgacgacaacgatgagcttaccatcaagctccacgcccttctcggcaacaagtaagcaaaacaaatttcaacgtgttgtcatctgctccggttagctcttcttgtgttcttggtgctgattgattggttctgcaggtggaacacgcacatcaagcgcaagctcatgagccagggcatcgatccgcagacgcatcagccggttagcgccgggactagcgttgccgcggcaagcgagctgaccacgacggccagcactgttggcttcccatccctgcaggcgccgacgccggcatga

CDS seq

atggggctgctccgctgccgaaagagctgctgcctccactggatgaactacctcagccccgacctcaagtgcagcaacttcaccgacgacaacgatgagcttaccatcaagctccacgcccttctcggcaacaagtggaacacgcacatcaagcgcaagctcatgagccagggcatcgatccgcagacgcatcagccggttagcgccgggactagcgttgccgcggcaagcgagctgaccacgacggccagcactgttggcttcccatccctgcaggcgccgacgccggcatga

Protein seq

MGLLRCRKSCCLHWMNYLSPDLKCSNFTDDNDELTIKLHALLGNKWNTHIKRKLMSQGIDPQTHQPVSAGTSVAAASELTTTASTVGFPSLQAPTPA

Function Transcription repressor MYB6 [UniProtKB/Swiss-Prot:Q38851]

Transcripts

Gene Transcript Chromosome Start End Strand Source
OsNaBo_03g0010220 OsNaBo_03g0010220.01 Chr03 7766396 7766773 + NAM
CDS seq

atggggctgctccgctgccgaaagagctgctgcctccactggatgaactacctcagccccgacctcaagtgcagcaacttcaccgacgacaacgatgagcttaccatcaagctccacgcccttctcggcaacaagtggaacacgcacatcaagcgcaagctcatgagccagggcatcgatccgcagacgcatcagccggttagcgccgggactagcgttgccgcggcaagcgagctgaccacgacggccagcactgttggcttcccatccctgcaggcgccgacgccggcatga

More
Protein seq

MGLLRCRKSCCLHWMNYLSPDLKCSNFTDDNDELTIKLHALLGNKWNTHIKRKLMSQGIDPQTHQPVSAGTSVAAASELTTTASTVGFPSLQAPTPA

Event Type Chromosome Start End Strand Alternative mRNAs Total mRNAs Source

Expression

Leaf Root Panicle
FPKM 0.0 0.0 0.0

Homologues

Genome & Annotation Homologs Type Expression(FPKM)
Leaf Root Panicle
Nipponbare | IRGSP 1.0 | Gramene(+IsoSeq) OsNip_03g0388600 SBH 0.0 0.0 0.0
Nipponbare | IRGSP 1.0 | MSU LOC_Os03g14100 RBH 0.0 0.0 0.0
Nipponbare | IRGSP 1.0 | RAP-db Os03g0388600 SBH None None None
Azucena | AzucenaRS1 | Gramene(+IsoSeq) OsAzu_03g0010600 RBH 0.0 0.0 0.0
KETAN NANGKA | Os128077RS1 | Gramene(+IsoSeq) OsKeNa_03g0010420 RBH 0.0 0.0 0.0
CHAO MEO | Os132278RS1 | Gramene(+IsoSeq) OsCMeo_03g0010520 RBH 0.0 0.0 0.0
ARC 10497 | Os117425RS1 | Gramene(+IsoSeq) OsARC_03g0010420 RBH 0.0 0.0 None
PR 106 | Os127742RS1 | Gramene(+IsoSeq) OsPr106_03g0010300 RBH 0.0 0.0 0.0
Minghui 63 | MH63RS3 | HZAU OsMH63_03G0126800 RBH 0 0 0
IR 64 | OsIR64RS1 | Gramene(+IsoSeq) OsIR64_03g0010200 RBH 0.0 0.0 0.0
Zhenshan 97 | ZS97RS3 | HZAU OsZS97_03G0126400 RBH 0 0 0
LIMA | Os127564RS1 | Gramene(+IsoSeq) OsLima_03g0010330 RBH 0.0 0.0 None
KHAO YAI GUANG | Os127518RS1 | Gramene(+IsoSeq) OsKYG_03g0010430 RBH 0.0 0.0 None
GOBOL SAIL | Os132424RS1 | Gramene(+IsoSeq) OsGoSa_03g0010310 RBH 0.0 0.0 None
LIU XU | Os125827RS1 | Gramene(+IsoSeq) OsLiXu_03g0010390 RBH 0.0 0.0 0.0
LARHA MUGAD | Os125619RS1 | Gramene(+IsoSeq) OsLaMu_03g0010330 RBH 0.0 0.0 None
N22 | OsN22RS2 | Gramene(+IsoSeq) OsN22_03G010340 RBH 0.0 0.0 0.0
NATEL BORO | Os127652RS1 | Gramene(+IsoSeq) OsNaBo_12g0002260 RBH 0.0 0.0 0.0
Powered by

© 2021- Rice Gene Index @Zhang Lab. All Rights Reserved.

National Key Laboratory of Crop Genetic Improvement

Huazhong Agricultural University

Any comments and suggestions, please contact us.