Basic Info

Gene ID OGI # | Score   Accession | Assembly | Annotation Location Links
OsNaBo_01g0027680 OGI:01083380 | 16/16 NATEL BORO | Os127652RS1 | Gramene(+IsoSeq) Chr01:27842297-27842710
Gene Symbol -
DNA seq

atggcttatacaaatgccactgcaagagaaattcccagctctattcaccccttccaggcaacaacaagcaacagtggcagtacatgcaaagaatattgttccgtctccaatttgcgcaaaatatgcagcttagcagatgaaacaacaagctacctctttcttcactgtccttttgcctctggtctatgggcttcactccacatcgatccaggtattgacgatgtaaaacaactccatgcattacaaccaccatcagtcatcccgacagcgcacttccgccccttctttctgctctgcctttggggactctggaaccaccgcgccatgatgccatcttcagaaaccaggagccttgtcatcgtcgcctcctccaacgatgtatcgaagacgcaactctctgggcacaccggttaa

More
CDS seq

atggcttatacaaatgccactgcaagagaaattcccagctctattcaccccttccaggcaacaacaagcaacagtggcagtacatgcaaagaatattgttccgtctccaatttgcgcaaaatatgcagcttagcagatgaaacaacaagctacctctttcttcactgtccttttgcctctggtctatgggcttcactccacatcgatccaggtattgacgatgtaaaacaactccatgcattacaaccaccatcagtcatcccgacagcgcacttccgccccttctttctgctctgcctttggggactctggaaccaccgcgccatgatgccatcttcagaaaccaggagccttgtcatcgtcgcctcctccaacgatgtatcgaagacgcaactctctgggcacaccggttaa

More
Protein seq

MAYTNATAREIPSSIHPFQATTSNSGSTCKEYCSVSNLRKICSLADETTSYLFLHCPFASGLWASLHIDPGIDDVKQLHALQPPSVIPTAHFRPFFLLCLWGLWNHRAMMPSSETRSLVIVASSNDVSKTQLSGHTG

Function -

Transcripts

Gene Transcript Chromosome Start End Strand Source
OsNaBo_01g0027680 OsNaBo_01g0027680.01 Chr01 27842297 27842710 + NAM
CDS seq

atggcttatacaaatgccactgcaagagaaattcccagctctattcaccccttccaggcaacaacaagcaacagtggcagtacatgcaaagaatattgttccgtctccaatttgcgcaaaatatgcagcttagcagatgaaacaacaagctacctctttcttcactgtccttttgcctctggtctatgggcttcactccacatcgatccaggtattgacgatgtaaaacaactccatgcattacaaccaccatcagtcatcccgacagcgcacttccgccccttctttctgctctgcctttggggactctggaaccaccgcgccatgatgccatcttcagaaaccaggagccttgtcatcgtcgcctcctccaacgatgtatcgaagacgcaactctctgggcacaccggttaa

More
Protein seq

MAYTNATAREIPSSIHPFQATTSNSGSTCKEYCSVSNLRKICSLADETTSYLFLHCPFASGLWASLHIDPGIDDVKQLHALQPPSVIPTAHFRPFFLLCLWGLWNHRAMMPSSETRSLVIVASSNDVSKTQLSGHTG

Event Type Chromosome Start End Strand Alternative mRNAs Total mRNAs Source

Expression

Leaf Root Panicle
FPKM 0.0 0.0 0.0

Homologues

Genome & Annotation Homologs Type Expression(FPKM)
Leaf Root Panicle
Nipponbare | IRGSP 1.0 | Gramene(+IsoSeq) NA NA NA NA NA
Nipponbare | IRGSP 1.0 | MSU LOC_Os01g47830 RBH 0.0 0.0 0.0
Nipponbare | IRGSP 1.0 | RAP-db Os01g0806600 RBH None None None
Azucena | AzucenaRS1 | Gramene(+IsoSeq) OsAzu_01g0028510 RBH 0.0 0.0 0.0
KETAN NANGKA | Os128077RS1 | Gramene(+IsoSeq) OsKeNa_01g0028040 RBH 0.0 0.0 0.0
CHAO MEO | Os132278RS1 | Gramene(+IsoSeq) OsCMeo_01g0028480 RBH 0.0 0.0 0.0
ARC 10497 | Os117425RS1 | Gramene(+IsoSeq) OsARC_01g0027710 RBH 0.0 0.0 None
PR 106 | Os127742RS1 | Gramene(+IsoSeq) OsPr106_01g0027480 RBH 0.0 0.0 0.0
Minghui 63 | MH63RS3 | HZAU OsMH63_01G0456300 RBH 0.019573 0.0116905 0.026954
IR 64 | OsIR64RS1 | Gramene(+IsoSeq) OsIR64_01g0027180 RBH 0.0 0.0 0.0
Zhenshan 97 | ZS97RS3 | HZAU OsZS97_01G0445200 RBH 0.111424 0 0.077399
LIMA | Os127564RS1 | Gramene(+IsoSeq) OsLima_01g0027430 RBH 0.0 0.0 None
KHAO YAI GUANG | Os127518RS1 | Gramene(+IsoSeq) OsKYG_01g0027350 RBH 0.017507 0.0 None
GOBOL SAIL | Os132424RS1 | Gramene(+IsoSeq) OsGoSa_01g0027670 RBH 0.0 0.0 None
LIU XU | Os125827RS1 | Gramene(+IsoSeq) OsLiXu_01g0027740 RBH 0.0 0.0 0.0
LARHA MUGAD | Os125619RS1 | Gramene(+IsoSeq) OsLaMu_01g0027550 RBH 0.0 0.0 None
N22 | OsN22RS2 | Gramene(+IsoSeq) OsN22_01G027940 RBH 0.298449 0.0 0.0
NATEL BORO | Os127652RS1 | Gramene(+IsoSeq) NA NA NA NA NA
Powered by

© 2021- Rice Gene Index @Zhang Lab. All Rights Reserved.

National Key Laboratory of Crop Genetic Improvement

Huazhong Agricultural University

Any comments and suggestions, please contact us.