Basic Info

Gene ID OGI # | Score   Accession | Assembly | Annotation Location Links
OsLima_11g0015100 OGI:11053960 | 12/16 LIMA | Os127564RS1 | Gramene(+IsoSeq) Chr11:19789805-19790131
Gene Symbol -
DNA seq

tcagagatagtaccatgttgcaggatctgaagattgagaactccatggttgaccaccagggctttggccggcgctgccgaagaagccgccagcgctgccgttgaagaagcagctgccgtcggtgaaggagcttggtggtggactagccgtgccatatcccgaactccggtgctctggcatacgcgccgccaaccctgaactgctctgctccggcaccatcgactccgcccgagctcctccctgggccttccgcatcggcaccgccgcaccctttcgagattgcgatgcagctggcttgcgcatctgagccgcatccaacttcagcat

CDS seq

atgctgaagttggatgcggctcagatgcgcaagccagctgcatcgcaatctcgaaagggtgcggcggtgccgatgcggaaggcccagggaggagctcgggcggagtcgatggtgccggagcagagcagttcagggttggcggcgcgtatgccagagcaccggagttcgggatatggcacggctagtccaccaccaagctccttcaccgacggcagctgcttcttcaacggcagcgctggcggcttcttcggcagcgccggccaaagccctggtggtcaaccatggagttctcaatcttcagatcctgcaacatggtactatctctga

Protein seq

MLKLDAAQMRKPAASQSRKGAAVPMRKAQGGARAESMVPEQSSSGLAARMPEHRSSGYGTASPPPSSFTDGSCFFNGSAGGFFGSAGQSPGGQPWSSQSSDPATWYYL

Function -

Transcripts

Gene Transcript Chromosome Start End Strand Source
OsLima_11g0015100 OsLima_11g0015100.01 Chr11 19789805 19790131 - NAM
CDS seq

atgctgaagttggatgcggctcagatgcgcaagccagctgcatcgcaatctcgaaagggtgcggcggtgccgatgcggaaggcccagggaggagctcgggcggagtcgatggtgccggagcagagcagttcagggttggcggcgcgtatgccagagcaccggagttcgggatatggcacggctagtccaccaccaagctccttcaccgacggcagctgcttcttcaacggcagcgctggcggcttcttcggcagcgccggccaaagccctggtggtcaaccatggagttctcaatcttcagatcctgcaacatggtactatctctga

More
Protein seq

MLKLDAAQMRKPAASQSRKGAAVPMRKAQGGARAESMVPEQSSSGLAARMPEHRSSGYGTASPPPSSFTDGSCFFNGSAGGFFGSAGQSPGGQPWSSQSSDPATWYYL

Event Type Chromosome Start End Strand Alternative mRNAs Total mRNAs Source

Expression

Leaf Root Panicle
FPKM 0.0 0.0 None

Homologues

Genome & Annotation Homologs Type Expression(FPKM)
Leaf Root Panicle
Nipponbare | IRGSP 1.0 | Gramene(+IsoSeq) OsNip_11g0506300 RBH 0.0 0.0 0.0
Nipponbare | IRGSP 1.0 | MSU LOC_Os11g31020 RBH 0.0 0.0 0.0
Nipponbare | IRGSP 1.0 | RAP-db Os11g0506300 RBH None None None
Azucena | AzucenaRS1 | Gramene(+IsoSeq) OsAzu_11g0014930 RBH 0.0 0.0 0.0
KETAN NANGKA | Os128077RS1 | Gramene(+IsoSeq) OsKeNa_11g0014860 RBH 0.0 0.0 0.0
CHAO MEO | Os132278RS1 | Gramene(+IsoSeq) OsCMeo_11g0014810 RBH 0.0 0.0 0.0
ARC 10497 | Os117425RS1 | Gramene(+IsoSeq) NA NA NA NA NA
PR 106 | Os127742RS1 | Gramene(+IsoSeq) OsPr106_11g0014900 RBH 0.0 0.0 0.0
Minghui 63 | MH63RS3 | HZAU OsMH63_11G0285100 RBH 0 0 0
IR 64 | OsIR64RS1 | Gramene(+IsoSeq) OsIR64_11g0015130 RBH 0.0 0.0 0.0
Zhenshan 97 | ZS97RS3 | HZAU OsZS97_11G0297600 RBH 0 0 0.0052115
LIMA | Os127564RS1 | Gramene(+IsoSeq) OsLima_Ung0003410 RBH 0.0 0.0 None
KHAO YAI GUANG | Os127518RS1 | Gramene(+IsoSeq) OsKYG_11g0015060 RBH 0.0 0.0 None
GOBOL SAIL | Os132424RS1 | Gramene(+IsoSeq) OsGoSa_11g0014760 RBH 0.000000 0.0 None
LIU XU | Os125827RS1 | Gramene(+IsoSeq) OsLiXu_11g0014510 RBH 0.0 0.0 0.0
LARHA MUGAD | Os125619RS1 | Gramene(+IsoSeq) NA NA NA NA NA
N22 | OsN22RS2 | Gramene(+IsoSeq) OsN22_11G014630 RBH 0.0 0.0 0.0
NATEL BORO | Os127652RS1 | Gramene(+IsoSeq) OsNaBo_11g0014920 RBH 0.0 0.0 0.0
Powered by

© 2021- Rice Gene Index @Zhang Lab. All Rights Reserved.

National Key Laboratory of Crop Genetic Improvement

Huazhong Agricultural University

Any comments and suggestions, please contact us.