Basic Info

Gene ID OGI # | Score   Accession | Assembly | Annotation Location Links
OsLima_11g0006090 OGI:11010070 | 16/16 LIMA | Os127564RS1 | Gramene(+IsoSeq) Chr11:4875290-4875607
Gene Symbol -
DNA seq

tcactccagtacgcgggggacgagcttgctgctgggcagcgccggtcggctgggacccgcgccccagtgcggcgccggcgggtgagcagccgcgccccacggcggctccggcggcagggctgccgtgccccaggacggctccgacagcgggaggcgggcagccgcgccccagggctgctccggcagcgggaggcgggtgcagggcggctccggcagcgggaggcgggcagccgcgcccctggccgcgccactggccggcagcaggaggcgggcagccgcgcccctggccggctgcgggaggagggaagccgcgcccat

CDS seq

atgggcgcggcttccctcctcccgcagccggccaggggcgcggctgcccgcctcctgctgccggccagtggcgcggccaggggcgcggctgcccgcctcccgctgccggagccgccctgcacccgcctcccgctgccggagcagccctggggcgcggctgcccgcctcccgctgtcggagccgtcctggggcacggcagccctgccgccggagccgccgtggggcgcggctgctcacccgccggcgccgcactggggcgcgggtcccagccgaccggcgctgcccagcagcaagctcgtcccccgcgtactggagtga

Protein seq

MGAASLLPQPARGAAARLLLPASGAARGAAARLPLPEPPCTRLPLPEQPWGAAARLPLSEPSWGTAALPPEPPWGAAAHPPAPHWGAGPSRPALPSSKLVPRVLE

Function -

Transcripts

Gene Transcript Chromosome Start End Strand Source
OsLima_11g0006090 OsLima_11g0006090.01 Chr11 4875290 4875607 - NAM
CDS seq

atgggcgcggcttccctcctcccgcagccggccaggggcgcggctgcccgcctcctgctgccggccagtggcgcggccaggggcgcggctgcccgcctcccgctgccggagccgccctgcacccgcctcccgctgccggagcagccctggggcgcggctgcccgcctcccgctgtcggagccgtcctggggcacggcagccctgccgccggagccgccgtggggcgcggctgctcacccgccggcgccgcactggggcgcgggtcccagccgaccggcgctgcccagcagcaagctcgtcccccgcgtactggagtga

More
Protein seq

MGAASLLPQPARGAAARLLLPASGAARGAAARLPLPEPPCTRLPLPEQPWGAAARLPLSEPSWGTAALPPEPPWGAAAHPPAPHWGAGPSRPALPSSKLVPRVLE

Event Type Chromosome Start End Strand Alternative mRNAs Total mRNAs Source

Expression

Leaf Root Panicle
FPKM 0.0 0.0 None

Homologues

Genome & Annotation Homologs Type Expression(FPKM)
Leaf Root Panicle
Nipponbare | IRGSP 1.0 | Gramene(+IsoSeq) NA NA NA NA NA
Nipponbare | IRGSP 1.0 | MSU LOC_Os05g51760 SBH 0.0 0.0 0.0
Nipponbare | IRGSP 1.0 | RAP-db NA NA NA NA NA
Azucena | AzucenaRS1 | Gramene(+IsoSeq) OsAzu_05g0029410 SBH 0.0 0.0 0.0
KETAN NANGKA | Os128077RS1 | Gramene(+IsoSeq) OsKeNa_05g0029210 SBH 0.0 0.0 0.0
CHAO MEO | Os132278RS1 | Gramene(+IsoSeq) OsCMeo_05g0029210 SBH 0.0 0.0 0.0
ARC 10497 | Os117425RS1 | Gramene(+IsoSeq) OsARC_05g0029260 SBH 0.0 0.0 None
PR 106 | Os127742RS1 | Gramene(+IsoSeq) OsPr106_11g0006070 RBH 0.0 0.0 0.0
Minghui 63 | MH63RS3 | HZAU OsMH63_08G0395600 SBH 0 0.0757095 0.0137425
IR 64 | OsIR64RS1 | Gramene(+IsoSeq) OsIR64_11g0006120 RBH 0.0 0.0 0.0
Zhenshan 97 | ZS97RS3 | HZAU OsZS97_11G0080500 RBH 0 0.008021 0
LIMA | Os127564RS1 | Gramene(+IsoSeq) OsLima_05g0029020 RBH 0.0 0.0 None
KHAO YAI GUANG | Os127518RS1 | Gramene(+IsoSeq) OsKYG_11g0006170 RBH 0.0 0.0 None
GOBOL SAIL | Os132424RS1 | Gramene(+IsoSeq) OsGoSa_11g0006160 RBH 0.0 0.0 None
LIU XU | Os125827RS1 | Gramene(+IsoSeq) OsLiXu_11g0006190 RBH 0.0 0.0 0.0
LARHA MUGAD | Os125619RS1 | Gramene(+IsoSeq) OsLaMu_11g0006170 RBH 0.0 0.0 None
N22 | OsN22RS2 | Gramene(+IsoSeq) OsN22_11G006220 RBH 0.0 0.0 0.0
NATEL BORO | Os127652RS1 | Gramene(+IsoSeq) OsNaBo_05g0029220 SBH 0.0 0.0 0.0
Powered by

© 2021- Rice Gene Index @Zhang Lab. All Rights Reserved.

National Key Laboratory of Crop Genetic Improvement

Huazhong Agricultural University

Any comments and suggestions, please contact us.