Basic Info

Gene ID OGI # | Score   Accession | Assembly | Annotation Location Links
OsLima_10g0003300 OGI:10013560 | 11/16 LIMA | Os127564RS1 | Gramene(+IsoSeq) Chr10:4434633-4435230
Gene Symbol -
DNA seq

gccaaaatttgcacaaaattcaaactcagattaagcaggaagaacagcacagtcaattaatgatggtagtagtaactaattcgttcatctttcacccatcctgaggctaactgaaatccattctgctcttcgcgaatgctaatctagctacctaactaagccatgaatcctgctctgccatggcggttcaacggtgagcggtgacgagggtctcgatgaagcgcagcccgtcgaaccgcggcgcgaaccggtcctccgccgcgctcctccgcccattccccctcgacgccggcgacccctgcagaagtaacaaacaaacacgcgcgagcgtgagcaatccacacccagccacaaggaacaaaggtctcgggatggagcgtgccgtgggattggagcatggggtgacgcagcgctcggtggcggcggcggtggcggcggacgcgacggcggtggccgcggccgaggcagtggcggcggcggcggcggcggcggcccacttcatctccggcagacggcgagggggggaggagagaccgccgcctcctctggagaagagcgagtgagctgagactgtgatggcggctgctgctgctgcagt

More
CDS seq

atgaagtgggccgccgccgccgccgccgccgccactgcctcggccgcggccaccgccgtcgcgtccgccgccaccgccgccgccaccgagcgctgcgtcaccccatgctccaatcccacggggtcgccggcgtcgagggggaatgggcggaggagcgcggcggaggaccggttcgcgccgcggttcgacgggctgcgcttcatcgagaccctcgtcaccgctcaccgttga

Protein seq

MKWAAAAAAAATASAAATAVASAATAAATERCVTPCSNPTGSPASRGNGRRSAAEDRFAPRFDGLRFIETLVTAHR

Function -

Transcripts

Gene Transcript Chromosome Start End Strand Source
OsLima_10g0003300 OsLima_10g0003300.01 Chr10 4434633 4435230 - NAM
CDS seq

atgaagtgggccgccgccgccgccgccgccgccactgcctcggccgcggccaccgccgtcgcgtccgccgccaccgccgccgccaccgagcgctgcgtcaccccatgctccaatcccacggggtcgccggcgtcgagggggaatgggcggaggagcgcggcggaggaccggttcgcgccgcggttcgacgggctgcgcttcatcgagaccctcgtcaccgctcaccgttga

More
Protein seq

MKWAAAAAAAATASAAATAVASAATAAATERCVTPCSNPTGSPASRGNGRRSAAEDRFAPRFDGLRFIETLVTAHR

Event Type Chromosome Start End Strand Alternative mRNAs Total mRNAs Source

Expression

Leaf Root Panicle
FPKM 0.386172 0.184048 None

Homologues

Genome & Annotation Homologs Type Expression(FPKM)
Leaf Root Panicle
Nipponbare | IRGSP 1.0 | Gramene(+IsoSeq) NA NA NA NA NA
Nipponbare | IRGSP 1.0 | MSU LOC_Os10g07450 RBH 0.516325 0.584071 0.519816
Nipponbare | IRGSP 1.0 | RAP-db Os10g0162100 RBH None None None
Azucena | AzucenaRS1 | Gramene(+IsoSeq) OsAzu_10g0003350 RBH 0.0 0.0 0.518143
KETAN NANGKA | Os128077RS1 | Gramene(+IsoSeq) OsKeNa_10g0003300 SBH 1.039631 5.266933 5.424708
CHAO MEO | Os132278RS1 | Gramene(+IsoSeq) OsCMeo_10g0003230 RBH 0.000000 0.0 2.047726
ARC 10497 | Os117425RS1 | Gramene(+IsoSeq) OsARC_10g0003530 SBH 0.380166 0.394354 None
PR 106 | Os127742RS1 | Gramene(+IsoSeq) OsPr106_10g0003250 SBH 19.487225 33.480709 20.653507
Minghui 63 | MH63RS3 | HZAU OsMH63_10G0065500 RBH 3.284315 3.0734855 16.6790835
IR 64 | OsIR64RS1 | Gramene(+IsoSeq) OsIR64_10g0003470 RBH 0.0 0.0 1.389654
Zhenshan 97 | ZS97RS3 | HZAU OsZS97_10G0073100 RBH 5.9099915 0.6775605 13.8712965
LIMA | Os127564RS1 | Gramene(+IsoSeq) OsLima_10g0003290 RBH 1.917082 0.483137 None
KHAO YAI GUANG | Os127518RS1 | Gramene(+IsoSeq) OsKYG_10g0003340 RBH 0.000000 0.0 None
GOBOL SAIL | Os132424RS1 | Gramene(+IsoSeq) OsGoSa_10g0003430 RBH 7.285769 0.000000 None
LIU XU | Os125827RS1 | Gramene(+IsoSeq) OsLiXu_10g0003190 RBH 0.0 0.0 0.0
LARHA MUGAD | Os125619RS1 | Gramene(+IsoSeq) OsLaMu_10g0003530 SBH 0.755525 0.000000 None
N22 | OsN22RS2 | Gramene(+IsoSeq) OsN22_10G003350 SBH 1.238168 8.613032 6.054692
NATEL BORO | Os127652RS1 | Gramene(+IsoSeq) OsNaBo_10g0003490 RBH 0.0 13.309935 7.924054
Powered by

© 2021- Rice Gene Index @Zhang Lab. All Rights Reserved.

National Key Laboratory of Crop Genetic Improvement

Huazhong Agricultural University

Any comments and suggestions, please contact us.