Basic Info

Gene ID OGI # | Score   Accession | Assembly | Annotation Location Links
OsLiXu_06g0023470 OGI:06072000 | 15/16 LIU XU | Os125827RS1 | Gramene(+IsoSeq) Chr06:26633683-26633874
Gene Symbol -
DNA seq

ctagcagcagtgtgtgcggccgctggaccctgatttcgccgcacggagcacctccgtaaccatcccaattccgctctccagccagccgtccccttccaacggcctcgccgcgacggaaaccacgctgacaacgtttattacgaacagcagcaacagcaccgtccccgccgtagccgccaccgtcgctgccat

CDS seq

atggcagcgacggtggcggctacggcggggacggtgctgttgctgctgttcgtaataaacgttgtcagcgtggtttccgtcgcggcgaggccgttggaaggggacggctggctggagagcggaattgggatggttacggaggtgctccgtgcggcgaaatcagggtccagcggccgcacacactgctgctag

Protein seq

MAATVAATAGTVLLLLFVINVVSVVSVAARPLEGDGWLESGIGMVTEVLRAAKSGSSGRTHCC

Function -

Transcripts

Gene Transcript Chromosome Start End Strand Source
OsLiXu_06g0023470 OsLiXu_06g0023470.01 Chr06 26633683 26633874 - NAM
CDS seq

atggcagcgacggtggcggctacggcggggacggtgctgttgctgctgttcgtaataaacgttgtcagcgtggtttccgtcgcggcgaggccgttggaaggggacggctggctggagagcggaattgggatggttacggaggtgctccgtgcggcgaaatcagggtccagcggccgcacacactgctgctag

Protein seq

MAATVAATAGTVLLLLFVINVVSVVSVAARPLEGDGWLESGIGMVTEVLRAAKSGSSGRTHCC

Event Type Chromosome Start End Strand Alternative mRNAs Total mRNAs Source

Expression

Leaf Root Panicle
FPKM 0.0 0.0 0.0

Homologues

Genome & Annotation Homologs Type Expression(FPKM)
Leaf Root Panicle
Nipponbare | IRGSP 1.0 | Gramene(+IsoSeq) NA NA NA NA NA
Nipponbare | IRGSP 1.0 | MSU NA NA NA NA NA
Nipponbare | IRGSP 1.0 | RAP-db NA NA NA NA NA
Azucena | AzucenaRS1 | Gramene(+IsoSeq) OsAzu_06g0023190 RBH 0.0 0.0 0.0
KETAN NANGKA | Os128077RS1 | Gramene(+IsoSeq) OsKeNa_06g0023020 RBH 0.0 0.0 0.0
CHAO MEO | Os132278RS1 | Gramene(+IsoSeq) OsCMeo_06g0023130 RBH 0.0 0.0 0.0
ARC 10497 | Os117425RS1 | Gramene(+IsoSeq) OsARC_06g0022780 RBH 0.0 0.0 None
PR 106 | Os127742RS1 | Gramene(+IsoSeq) OsPr106_06g0023200 RBH 0.0 0.0 0.0
Minghui 63 | MH63RS3 | HZAU OsMH63_06G0399700 RBH 0 0 0
IR 64 | OsIR64RS1 | Gramene(+IsoSeq) OsIR64_06g0022670 RBH 0.0 0.0 0.0
Zhenshan 97 | ZS97RS3 | HZAU OsZS97_06G0380500 RBH 0 0 0
LIMA | Os127564RS1 | Gramene(+IsoSeq) OsLima_06g0023140 RBH 0.0 0.0 None
KHAO YAI GUANG | Os127518RS1 | Gramene(+IsoSeq) OsKYG_06g0023080 RBH 0.0 0.0 None
GOBOL SAIL | Os132424RS1 | Gramene(+IsoSeq) OsGoSa_06g0022730 RBH 0.0 0.0 None
LIU XU | Os125827RS1 | Gramene(+IsoSeq) NA NA NA NA NA
LARHA MUGAD | Os125619RS1 | Gramene(+IsoSeq) OsLaMu_06g0023020 RBH 0.0 0.0 None
N22 | OsN22RS2 | Gramene(+IsoSeq) OsN22_06G022760 RBH 0.0 0.0 0.0
NATEL BORO | Os127652RS1 | Gramene(+IsoSeq) OsNaBo_06g0023000 RBH 0.0 0.0 0.0
Powered by

© 2021- Rice Gene Index @Zhang Lab. All Rights Reserved.

National Key Laboratory of Crop Genetic Improvement

Huazhong Agricultural University

Any comments and suggestions, please contact us.