Basic Info

Gene ID OGI # | Score   Accession | Assembly | Annotation Location Links
OsLiXu_01g0045540 OGI:01120970 | 16/16 LIU XU | Os125827RS1 | Gramene(+IsoSeq) Chr01:42805823-42806598
Gene Symbol -
DNA seq

atgggtatgtgtattttgcccccgcgtcgcctcccctacgggcgacacgggaggcggaaaccgctggcgtcgcccactcctCccccctcctccctctgccgcctcgccgcgcggccgcaaggacggcggtggcggggcttcacccttgtcttcgtctctctctcccgtcacggtggggggccgcgcgtgggacgcgcgaagaccgcccagatccaggccaccacggccggatctagcggggaggccgccggtggcgggtcggtgtgaggtggcggcggcagttggtggtggtggcggcggggattgaaggtggcggggtggtggcggcagttggtggcggctggcaccggggaaggcaacgacggtggcggggGAgacggcaacgacgacagggatggcgtgcgtgctgcttctcttgcttggggcgtctgcagtggggttggagatggcggcggggatggaggtggcggcgaggttggcgacggaggccggatctggcggcgaggctggcatcggcgaccagatccaggcgttggagatggttttgccccggtggcggttgcgacggcagcggagagctcggcgacggcgttggggcggttgcgttggtggtgccggcggtttgcgacgacgactgctggcgtcgatggctggtgacagtggcatcagcgacggcggccgacttgcagcggctgtgactgaggatacggtggcgacgtcgaaggatgcggcagtggaggcggggaaggagttgggtgtgaggtgacagcggcgac

More
CDS seq

atgggtatgtgtattttgcccccgcgtcgcctcccctacgggcgacacgggaggcggaaaccgctggcgtcgcccactcctCccccctcctccctctgccgcctcgccgcgcggccgcaaggacggcggtggcggggcttcacccttgtcttcgtctctctctcccgtcacggtggggggccgcgcgtgggacgcgcgaagaccgcccagatccaggccaccacggccggatctagcggggaggccgccggtggcgggtcgatggcggcggggatggaggtggcggcgaggttggcgacggaggccggatctggcggcgaggctggcatcggcgaccagatccaggcgttggagatggttttgccccggtggcggttgcgacggcagcggagagctcggcgacggcgttggggcggttgcgttggtggtgccggcggtttgcgacgacgactgctggcgtcgatggctggtgacagtggcatcagcgacggcggccgacttgcagcggctgtgactgaggatacggtggcgacgtcgaaggatgcggcagtggaggcggggaaggagttgggtgtgaggtga

More
Protein seq

MGMCILPPRRLPYGRHGRRKPLASPTPPPSSLCRLAARPQGRRWRGFTLVFVSLSRHGGGPRVGRAKTAQIQATTAGSSGEAAGGGSMAAGMEVAARLATEAGSGGEAGIGDQIQALEMVLPRWRLRRQRRARRRRWGGCVGGAGGLRRRLLASMAGDSGISDGGRLAAAVTEDTVATSKDAAVEAGKELGVR

Function -

Transcripts

Gene Transcript Chromosome Start End Strand Source
OsLiXu_01g0045540 OsLiXu_01g0045540.01 Chr01 42805823 42806598 + NAM
CDS seq

atgggtatgtgtattttgcccccgcgtcgcctcccctacgggcgacacgggaggcggaaaccgctggcgtcgcccactcctCccccctcctccctctgccgcctcgccgcgcggccgcaaggacggcggtggcggggcttcacccttgtcttcgtctctctctcccgtcacggtggggggccgcgcgtgggacgcgcgaagaccgcccagatccaggccaccacggccggatctagcggggaggccgccggtggcgggtcgatggcggcggggatggaggtggcggcgaggttggcgacggaggccggatctggcggcgaggctggcatcggcgaccagatccaggcgttggagatggttttgccccggtggcggttgcgacggcagcggagagctcggcgacggcgttggggcggttgcgttggtggtgccggcggtttgcgacgacgactgctggcgtcgatggctggtgacagtggcatcagcgacggcggccgacttgcagcggctgtgactgaggatacggtggcgacgtcgaaggatgcggcagtggaggcggggaaggagttgggtgtgaggtga

More
Protein seq

MGMCILPPRRLPYGRHGRRKPLASPTPPPSSLCRLAARPQGRRWRGFTLVFVSLSRHGGGPRVGRAKTAQIQATTAGSSGEAAGGGSMAAGMEVAARLATEAGSGGEAGIGDQIQALEMVLPRWRLRRQRRARRRRWGGCVGGAGGLRRRLLASMAGDSGISDGGRLAAAVTEDTVATSKDAAVEAGKELGVR

Event Type Chromosome Start End Strand Alternative mRNAs Total mRNAs Source

Expression

Leaf Root Panicle
FPKM 0.0 0.0 0.0

Homologues

Genome & Annotation Homologs Type Expression(FPKM)
Leaf Root Panicle
Nipponbare | IRGSP 1.0 | Gramene(+IsoSeq) NA NA NA NA NA
Nipponbare | IRGSP 1.0 | MSU LOC_Os01g71020 RBH 0.0 0.0 0.0
Nipponbare | IRGSP 1.0 | RAP-db NA NA NA NA NA
Azucena | AzucenaRS1 | Gramene(+IsoSeq) OsAzu_01g0046290 RBH 0.0 0.0 0.0
KETAN NANGKA | Os128077RS1 | Gramene(+IsoSeq) OsKeNa_01g0045800 RBH 0.0 0.0 0.0
CHAO MEO | Os132278RS1 | Gramene(+IsoSeq) OsCMeo_01g0046190 RBH 0.0 0.0 0.0
ARC 10497 | Os117425RS1 | Gramene(+IsoSeq) OsARC_01g0045710 RBH 0.0 0.0 None
PR 106 | Os127742RS1 | Gramene(+IsoSeq) OsPr106_01g0045290 RBH 0.0 0.0 0.0
Minghui 63 | MH63RS3 | HZAU OsMH63_01G0676700 RBH 0 0.0796345 0.012286
IR 64 | OsIR64RS1 | Gramene(+IsoSeq) OsIR64_01g0044810 RBH 0.0 0.0 0.0
Zhenshan 97 | ZS97RS3 | HZAU OsZS97_01G0672100 RBH 2.3195035 6.4898225 14.559013
LIMA | Os127564RS1 | Gramene(+IsoSeq) OsLima_01g0045250 RBH 0.0 0.0 None
KHAO YAI GUANG | Os127518RS1 | Gramene(+IsoSeq) OsKYG_01g0045200 RBH 0.0 0.0 None
GOBOL SAIL | Os132424RS1 | Gramene(+IsoSeq) OsGoSa_01g0013090 SBH 0.0 0.0 None
LIU XU | Os125827RS1 | Gramene(+IsoSeq) NA NA NA NA NA
LARHA MUGAD | Os125619RS1 | Gramene(+IsoSeq) OsLaMu_01g0045250 RBH 0.0 0.0 None
N22 | OsN22RS2 | Gramene(+IsoSeq) OsN22_01G045620 RBH 0.0 0.0 0.0
NATEL BORO | Os127652RS1 | Gramene(+IsoSeq) OsNaBo_01g0045330 RBH 0.0 0.0 0.0
Powered by

© 2021- Rice Gene Index @Zhang Lab. All Rights Reserved.

National Key Laboratory of Crop Genetic Improvement

Huazhong Agricultural University

Any comments and suggestions, please contact us.