Basic Info

Gene ID OGI # | Score   Accession | Assembly | Annotation Location Links
OsLaMu_08g0022010 OGI:08073370 | 16/16 LARHA MUGAD | Os125619RS1 | Gramene(+IsoSeq) Chr08:27288705-27288962
Gene Symbol -
DNA seq

ctatatcccaactctcttcttcaactcagcagcaatcaccgggaatttctgcagcagcactgcaaaaccatcggtgaaagcggccttcttgaaattgttctcggcagcaaagaagtcgatgcacttgttcttcagctccgggcagttgtaggtctctgcgcaagccaagatatcggcaactgaatccgccgtcatgttctgcagcaatctctgtgcacacatgagcttcagcctgtcaagcgcgtacctgtcggccat

CDS seq

atggccgacaggtacgcgcttgacaggctgaagctcatgtgtgcacagagattgctgcagaacatgacggcggattcagttgccgatatcttggcttgcgcagagacctacaactgcccggagctgaagaacaagtgcatcgacttctttgctgccgagaacaatttcaagaaggccgctttcaccgatggttttgcagtgctgctgcagaaattcccggtgattgctgctgagttgaagaagagagttgggatatag

Protein seq

MADRYALDRLKLMCAQRLLQNMTADSVADILACAETYNCPELKNKCIDFFAAENNFKKAAFTDGFAVLLQKFPVIAAELKKRVGI

Function BTB/POZ and MATH domain-containing protein 2 [UniProtKB/Swiss-Prot:Q9M8J9]

Transcripts

Gene Transcript Chromosome Start End Strand Source
OsLaMu_08g0022010 OsLaMu_08g0022010.01 Chr08 27288705 27288962 - NAM
CDS seq

atggccgacaggtacgcgcttgacaggctgaagctcatgtgtgcacagagattgctgcagaacatgacggcggattcagttgccgatatcttggcttgcgcagagacctacaactgcccggagctgaagaacaagtgcatcgacttctttgctgccgagaacaatttcaagaaggccgctttcaccgatggttttgcagtgctgctgcagaaattcccggtgattgctgctgagttgaagaagagagttgggatatag

More
Protein seq

MADRYALDRLKLMCAQRLLQNMTADSVADILACAETYNCPELKNKCIDFFAAENNFKKAAFTDGFAVLLQKFPVIAAELKKRVGI

Event Type Chromosome Start End Strand Alternative mRNAs Total mRNAs Source

Expression

Leaf Root Panicle
FPKM 0.0 0.0 None

Homologues

Genome & Annotation Homologs Type Expression(FPKM)
Leaf Root Panicle
Nipponbare | IRGSP 1.0 | Gramene(+IsoSeq) OsNip_08g0523400 SBH 0.0 0.0 0.0
Nipponbare | IRGSP 1.0 | MSU LOC_Os08g41190 SBH 0.0 0.0 0.0
Nipponbare | IRGSP 1.0 | RAP-db Os08g0523400 SBH None None None
Azucena | AzucenaRS1 | Gramene(+IsoSeq) OsAzu_08g0022640 SBH 0.000000 0.198087 0.000000
KETAN NANGKA | Os128077RS1 | Gramene(+IsoSeq) OsKeNa_08g0022520 SBH 0.000000 0.094169 0.028506
CHAO MEO | Os132278RS1 | Gramene(+IsoSeq) OsCMeo_08g0022420 RBH 0.058541 0.230410 0.000000
ARC 10497 | Os117425RS1 | Gramene(+IsoSeq) OsARC_08g0022580 RBH 0.0 0.0 None
PR 106 | Os127742RS1 | Gramene(+IsoSeq) OsPr106_08g0022410 SBH 0.000000 0.000000 0.000000
Minghui 63 | MH63RS3 | HZAU OsMH63_08G0414600 RBH 0.0426245 0.4399015 0.05201
IR 64 | OsIR64RS1 | Gramene(+IsoSeq) OsIR64_08g0022320 RBH 0.0 0.0 0.841263
Zhenshan 97 | ZS97RS3 | HZAU OsZS97_08G0436000 SBH 0.0597825 0 0.0381145
LIMA | Os127564RS1 | Gramene(+IsoSeq) OsLima_08g0021660 SBH 0.000000 0.000000 None
KHAO YAI GUANG | Os127518RS1 | Gramene(+IsoSeq) OsKYG_08g0022010 RBH 0.0 0.0 None
GOBOL SAIL | Os132424RS1 | Gramene(+IsoSeq) OsGoSa_08g0021810 RBH 0.0 0.000000 None
LIU XU | Os125827RS1 | Gramene(+IsoSeq) OsLiXu_08g0022610 SBH 0.000000 0.000000 0.000000
LARHA MUGAD | Os125619RS1 | Gramene(+IsoSeq) OsLaMu_08g0022000 RBH 0.0 0.0 None
N22 | OsN22RS2 | Gramene(+IsoSeq) OsN22_08G022150 RBH 0.0 0.000000 0.089066
NATEL BORO | Os127652RS1 | Gramene(+IsoSeq) OsNaBo_08g0022330 SBH 0.000000 0.000000 0.000000
Powered by

© 2021- Rice Gene Index @Zhang Lab. All Rights Reserved.

National Key Laboratory of Crop Genetic Improvement

Huazhong Agricultural University

Any comments and suggestions, please contact us.