Basic Info

Gene ID OGI # | Score   Accession | Assembly | Annotation Location Links
OsLaMu_04g0020420 OGI:04078640 | 16/16 LARHA MUGAD | Os125619RS1 | Gramene(+IsoSeq) Chr04:27112476-27112992
Gene Symbol -
DNA seq

atggcgaagaccgcccagatccgggccgccgcggccggatctggcggggaggccgccggaggcgggtcggtgtgaggtggcggcaacagttggtggtggtggcggcggggattgaaggtggcggggtggcggcggcagttggtggcggctggcgccggggaaggcgacgacggtggcgggggagacggcgacggcgacagggatgtcgtgcgtgctggtggcgtgctgcttctcttgctgggggcgtcggcggcggggttggagatggcggcggggatggaggtggcggcgaggctggtgacggaggccggatctggcggtgaggctggcatcggcgaccggatccaggcgctggagatggttttgccccagtgacggtcgcgatggcagcggagagctcggcgacggcgttgttgcggttgcgttggcggtgccggcggtttgcgacgacgactgctggcgtcggtggctggtgacagcggcatcagcaacggcggccgacttgcagcggccgtga

More
CDS seq

atggcgaagaccgcccagatccgggccgccgcggccggatctggcggggaggccgccggaggcgggtcggttgacggtcgcgatggcagcggagagctcggcgacggcgttgttgcggttgcgttggcggtgccggcggtttgcgacgacgactgctggcgtcggtggctggtgacagcggcatcagcaacggcggccgacttgcagcggccgtga

Protein seq

MAKTAQIRAAAAGSGGEAAGGGSVDGRDGSGELGDGVVAVALAVPAVCDDDCWRRWLVTAASATAADLQRP

Function -

Transcripts

Gene Transcript Chromosome Start End Strand Source
OsLaMu_04g0020420 OsLaMu_04g0020420.01 Chr04 27112476 27112992 + NAM
CDS seq

atggcgaagaccgcccagatccgggccgccgcggccggatctggcggggaggccgccggaggcgggtcggttgacggtcgcgatggcagcggagagctcggcgacggcgttgttgcggttgcgttggcggtgccggcggtttgcgacgacgactgctggcgtcggtggctggtgacagcggcatcagcaacggcggccgacttgcagcggccgtga

More
Protein seq

MAKTAQIRAAAAGSGGEAAGGGSVDGRDGSGELGDGVVAVALAVPAVCDDDCWRRWLVTAASATAADLQRP

Event Type Chromosome Start End Strand Alternative mRNAs Total mRNAs Source

Expression

Leaf Root Panicle
FPKM 0.0 0.0 None

Homologues

Genome & Annotation Homologs Type Expression(FPKM)
Leaf Root Panicle
Nipponbare | IRGSP 1.0 | Gramene(+IsoSeq) NA NA NA NA NA
Nipponbare | IRGSP 1.0 | MSU NA NA NA NA NA
Nipponbare | IRGSP 1.0 | RAP-db NA NA NA NA NA
Azucena | AzucenaRS1 | Gramene(+IsoSeq) OsAzu_04g0020200 RBH 0.0 0.0 0.0
KETAN NANGKA | Os128077RS1 | Gramene(+IsoSeq) OsKeNa_04g0020980 RBH 0.0 0.000000 0.0
CHAO MEO | Os132278RS1 | Gramene(+IsoSeq) OsCMeo_04g0020700 RBH 0.0 0.0 0.0
ARC 10497 | Os117425RS1 | Gramene(+IsoSeq) OsARC_04g0020430 RBH 0.0 0.0 None
PR 106 | Os127742RS1 | Gramene(+IsoSeq) OsPr106_04g0020620 RBH 0.0 0.0 0.0
Minghui 63 | MH63RS3 | HZAU NA NA NA NA NA
IR 64 | OsIR64RS1 | Gramene(+IsoSeq) OsIR64_04g0019420 RBH 0.0 0.0 0.0
Zhenshan 97 | ZS97RS3 | HZAU NA NA NA NA NA
LIMA | Os127564RS1 | Gramene(+IsoSeq) OsLima_04g0019910 RBH 0.0 0.0 None
KHAO YAI GUANG | Os127518RS1 | Gramene(+IsoSeq) OsKYG_04g0019770 RBH 0.0 0.0 None
GOBOL SAIL | Os132424RS1 | Gramene(+IsoSeq) OsGoSa_04g0019880 RBH 0.0 0.0 None
LIU XU | Os125827RS1 | Gramene(+IsoSeq) OsLiXu_04g0020250 RBH 0.0 0.0 0.0
LARHA MUGAD | Os125619RS1 | Gramene(+IsoSeq) NA NA NA NA NA
N22 | OsN22RS2 | Gramene(+IsoSeq) OsN22_04G019690 RBH 0.0 0.0 0.0
NATEL BORO | Os127652RS1 | Gramene(+IsoSeq) OsNaBo_04g0019640 RBH 0.0 0.0 0.0
Powered by

© 2021- Rice Gene Index @Zhang Lab. All Rights Reserved.

National Key Laboratory of Crop Genetic Improvement

Huazhong Agricultural University

Any comments and suggestions, please contact us.