Basic Info

Gene ID OGI # | Score   Accession | Assembly | Annotation Location Links
OsKeNa_11g0004540 OGI:04076220 | 14/16 KETAN NANGKA | Os128077RS1 | Gramene(+IsoSeq) Chr11:3295307-3295510
Gene Symbol -
DNA seq

atgcccgtgacgccttcctccatgatgccggcgacccgcgcttcgcgctgcacctctgatccgcgccaccccggccggatctggacggctggcgtctggcagcgctggctagcgacggtggcggctgacggtggtggctggacggtggtggctggacgggggtgtccgtggaggtggcggtcggctgacggtggcggctggtga

CDS seq

atgcccgtgacgccttcctccatgatgccggcgacccgcgcttcgcgctgcacctctgatccgcgccaccccggccggatctggacggctggcgtctggcagcgctggctagcgacggtggcggctgacggtggtggctggacggtggtggctggacgggggtgtccgtggaggtggcggtcggctgacggtggcggctggtga

Protein seq

MPVTPSSMMPATRASRCTSDPRHPGRIWTAGVWQRWLATVAADGGGWTVVAGRGCPWRWRSADGGGW

Function -

Transcripts

Gene Transcript Chromosome Start End Strand Source
OsKeNa_11g0004540 OsKeNa_11g0004540.01 Chr11 3295307 3295510 + NAM
CDS seq

atgcccgtgacgccttcctccatgatgccggcgacccgcgcttcgcgctgcacctctgatccgcgccaccccggccggatctggacggctggcgtctggcagcgctggctagcgacggtggcggctgacggtggtggctggacggtggtggctggacgggggtgtccgtggaggtggcggtcggctgacggtggcggctggtga

More
Protein seq

MPVTPSSMMPATRASRCTSDPRHPGRIWTAGVWQRWLATVAADGGGWTVVAGRGCPWRWRSADGGGW

Event Type Chromosome Start End Strand Alternative mRNAs Total mRNAs Source

Expression

Leaf Root Panicle
FPKM 0.0 0.0 0.0

Homologues

Genome & Annotation Homologs Type Expression(FPKM)
Leaf Root Panicle
Nipponbare | IRGSP 1.0 | Gramene(+IsoSeq) NA NA NA NA NA
Nipponbare | IRGSP 1.0 | MSU LOC_Os04g42399 RBH 0.0 0.0 0.0
Nipponbare | IRGSP 1.0 | RAP-db NA NA NA NA NA
Azucena | AzucenaRS1 | Gramene(+IsoSeq) OsAzu_11g0004510 RBH 0.0 0.000000 0.0
KETAN NANGKA | Os128077RS1 | Gramene(+IsoSeq) NA NA NA NA NA
CHAO MEO | Os132278RS1 | Gramene(+IsoSeq) OsCMeo_11g0004510 RBH 0.0 0.0 0.0
ARC 10497 | Os117425RS1 | Gramene(+IsoSeq) OsARC_11g0004450 RBH 0.0 0.0 None
PR 106 | Os127742RS1 | Gramene(+IsoSeq) OsPr106_11g0004370 RBH 0.000000 0.0 0.0
Minghui 63 | MH63RS3 | HZAU OsMH63_11G0056400 RBH 0 0 0
IR 64 | OsIR64RS1 | Gramene(+IsoSeq) OsIR64_01g0018940 SBH 0.287744 0.085985 1.328536
Zhenshan 97 | ZS97RS3 | HZAU OsZS97_11G0057000 RBH 0 0 0
LIMA | Os127564RS1 | Gramene(+IsoSeq) OsLima_11g0004380 RBH 0.000000 0.0 None
KHAO YAI GUANG | Os127518RS1 | Gramene(+IsoSeq) OsKYG_11g0004450 RBH 0.0 0.0 None
GOBOL SAIL | Os132424RS1 | Gramene(+IsoSeq) OsGoSa_11g0004450 RBH 0.0 0.0 None
LIU XU | Os125827RS1 | Gramene(+IsoSeq) OsLiXu_11g0004410 RBH 0.0 0.0 0.0
LARHA MUGAD | Os125619RS1 | Gramene(+IsoSeq) OsLaMu_11g0004460 RBH 0.000000 0.0 None
N22 | OsN22RS2 | Gramene(+IsoSeq) OsN22_11G004490 RBH 0.0 0.0 0.0
NATEL BORO | Os127652RS1 | Gramene(+IsoSeq) NA NA NA NA NA
Powered by

© 2021- Rice Gene Index @Zhang Lab. All Rights Reserved.

National Key Laboratory of Crop Genetic Improvement

Huazhong Agricultural University

Any comments and suggestions, please contact us.