Basic Info

Gene ID OGI # | Score   Accession | Assembly | Annotation Location Links
OsGoSa_11g0006850 OGI:11015600 | 12/16 GOBOL SAIL | Os132424RS1 | Gramene(+IsoSeq) Chr11:5652881-5653252
Gene Symbol -
DNA seq

atgtgcagtctcgccaccgacttccagaggtggcgccagcgccgcgcgagcacgcacgtgcgcacggcctccggcgccgggaggaaaccgaggatgtgttggaggacaccatccggcagatccctatcctatcgacgccgccgccgccgccgccgctggcgctcggacgtggggctttccccggaggcattccgtcgaacaggcggcgtgcgtcggggccacaccgcaagaaacagctggaactcacaatggaggatgcgagagagagagagagatggaggcctcgccgtcggcagcctcgggcgccgcaccggagcaggaggagtcgaggcgaagtggtccaaccctagtgctgtgaggattggggagtga

CDS seq

atgtgcagtctcgccaccgacttccagaggtggcgccagcgccgcgcgagcacgcacgtgcgcacggcctccggcgccgggaggaaaccgaggatgtgttggaggacaccatccggcagatccctatcctatcgacgccgccgccgccgccgccgctggcgctcggacgtggggctttccccggaggcattccgtcgaacaggcggcgtgcgtcggggccacaccgcaagaaacagctggaactcacaatggaggatgcgagagagagagagagatggaggcctcgccgtcggcagcctcgggcgccgcaccggagcaggaggagtcgaggcgaagtggtccaaccctagtgctgtgaggattggggagtga

Protein seq

MCSLATDFQRWRQRRASTHVRTASGAGRKPRMCWRTPSGRSLSYRRRRRRRRWRSDVGLSPEAFRRTGGVRRGHTARNSWNSQWRMRERERDGGLAVGSLGRRTGAGGVEAKWSNPSAVRIGE

Function -

Transcripts

Gene Transcript Chromosome Start End Strand Source
OsGoSa_11g0006850 OsGoSa_11g0006850.01 Chr11 5652881 5653252 + NAM
CDS seq

atgtgcagtctcgccaccgacttccagaggtggcgccagcgccgcgcgagcacgcacgtgcgcacggcctccggcgccgggaggaaaccgaggatgtgttggaggacaccatccggcagatccctatcctatcgacgccgccgccgccgccgccgctggcgctcggacgtggggctttccccggaggcattccgtcgaacaggcggcgtgcgtcggggccacaccgcaagaaacagctggaactcacaatggaggatgcgagagagagagagagatggaggcctcgccgtcggcagcctcgggcgccgcaccggagcaggaggagtcgaggcgaagtggtccaaccctagtgctgtgaggattggggagtga

More
Protein seq

MCSLATDFQRWRQRRASTHVRTASGAGRKPRMCWRTPSGRSLSYRRRRRRRRWRSDVGLSPEAFRRTGGVRRGHTARNSWNSQWRMRERERDGGLAVGSLGRRTGAGGVEAKWSNPSAVRIGE

Event Type Chromosome Start End Strand Alternative mRNAs Total mRNAs Source

Expression

Leaf Root Panicle
FPKM 0.000000 0.0 None

Homologues

Genome & Annotation Homologs Type Expression(FPKM)
Leaf Root Panicle
Nipponbare | IRGSP 1.0 | Gramene(+IsoSeq) OsNip_11g0208500 SBH 0.000000 0.000000 0.000000
Nipponbare | IRGSP 1.0 | MSU NA NA NA NA NA
Nipponbare | IRGSP 1.0 | RAP-db Os11g0208500 SBH None None None
Azucena | AzucenaRS1 | Gramene(+IsoSeq) OsAzu_11g0006890 SBH 0.000000 0.000000 0.000000
KETAN NANGKA | Os128077RS1 | Gramene(+IsoSeq) NA NA NA NA NA
CHAO MEO | Os132278RS1 | Gramene(+IsoSeq) OsCMeo_11g0006840 RBH 0.000000 0.000000 0.000000
ARC 10497 | Os117425RS1 | Gramene(+IsoSeq) OsARC_11g0006850 SBH 0.000000 0.198682 None
PR 106 | Os127742RS1 | Gramene(+IsoSeq) NA NA NA NA NA
Minghui 63 | MH63RS3 | HZAU NA NA NA NA NA
IR 64 | OsIR64RS1 | Gramene(+IsoSeq) NA NA NA NA NA
Zhenshan 97 | ZS97RS3 | HZAU NA NA NA NA NA
LIMA | Os127564RS1 | Gramene(+IsoSeq) NA NA NA NA NA
KHAO YAI GUANG | Os127518RS1 | Gramene(+IsoSeq) NA NA NA NA NA
GOBOL SAIL | Os132424RS1 | Gramene(+IsoSeq) OsGoSa_11g0006770 RBH 0.0 0.000000 None
LIU XU | Os125827RS1 | Gramene(+IsoSeq) OsLiXu_11g0006880 RBH 0.000000 0.0 0.000000
LARHA MUGAD | Os125619RS1 | Gramene(+IsoSeq) OsLaMu_11g0006640 SBH 0.0 0.000000 None
N22 | OsN22RS2 | Gramene(+IsoSeq) OsN22_11G006800 SBH 0.000000 0.000000 0.000000
NATEL BORO | Os127652RS1 | Gramene(+IsoSeq) OsNaBo_11g0006630 SBH 0.000000 0.000000 0.000000
Powered by

© 2021- Rice Gene Index @Zhang Lab. All Rights Reserved.

National Key Laboratory of Crop Genetic Improvement

Huazhong Agricultural University

Any comments and suggestions, please contact us.