Basic Info

Gene ID OGI # | Score   Accession | Assembly | Annotation Location Links
OsPr106_02g0001410 OGI:02003970 | 16/16 PR 106 | Os127742RS1 | Gramene(+IsoSeq) Chr02:959187-959393
Gene Symbol -
DNA seq

atgcactataggagacctggagctggaagcgagggccctttgagctcttgcaccatgataaagaagctcgagaaagtgaagacagcaaaaagatccgttgtccacgatgctgccttgaaccacctggagtacataagaggttccaccaggtaccctctggagcgaaatgctgggggcggttacttctgcatgatcaacgacagatag

CDS seq

atgcactataggagacctggagctggaagcgagggccctttgagctcttgcaccatgataaagaagctcgagaaagtgaagacagcaaaaagatccgttgtccacgatgctgccttgaaccacctggagtacataagaggttccaccaggtaccctctggagcgaaatgctgggggcggttacttctgcatgatcaacgacagatag

Protein seq

MHYRRPGAGSEGPLSSCTMIKKLEKVKTAKRSVVHDAALNHLEYIRGSTRYPLERNAGGGYFCMINDR

Function Sialyltransferase-like protein 4 [UniProtKB/Swiss-Prot:Q6ZH45]

Transcripts

Gene Transcript Chromosome Start End Strand Source
OsPr106_02g0001410 OsPr106_02g0001410.01 Chr02 959187 959393 + NAM
CDS seq

atgcactataggagacctggagctggaagcgagggccctttgagctcttgcaccatgataaagaagctcgagaaagtgaagacagcaaaaagatccgttgtccacgatgctgccttgaaccacctggagtacataagaggttccaccaggtaccctctggagcgaaatgctgggggcggttacttctgcatgatcaacgacagatag

More
Protein seq

MHYRRPGAGSEGPLSSCTMIKKLEKVKTAKRSVVHDAALNHLEYIRGSTRYPLERNAGGGYFCMINDR

Event Type Chromosome Start End Strand Alternative mRNAs Total mRNAs Source

Expression

Leaf Root Panicle
FPKM 0.0 0.0 0.0

Homologues

Genome & Annotation Homologs Type Expression(FPKM)
Leaf Root Panicle
Nipponbare | IRGSP 1.0 | Gramene(+IsoSeq) OsNip_02g0119000 RBH 0.0 0.0 0.0
Nipponbare | IRGSP 1.0 | MSU LOC_Os02g02620 SBH 0.173884 0.0 0.508225
Nipponbare | IRGSP 1.0 | RAP-db Os02g0119000 RBH None None None
Azucena | AzucenaRS1 | Gramene(+IsoSeq) OsAzu_02g0001390 RBH 0.0 0.0 0.0
KETAN NANGKA | Os128077RS1 | Gramene(+IsoSeq) OsKeNa_02g0001450 RBH 0.0 0.0 0.0
CHAO MEO | Os132278RS1 | Gramene(+IsoSeq) OsCMeo_02g0001400 RBH 0.0 0.0 0.0
ARC 10497 | Os117425RS1 | Gramene(+IsoSeq) OsARC_02g0001380 RBH 0.0 0.0 None
PR 106 | Os127742RS1 | Gramene(+IsoSeq) OsPr106_02g0001340 RBH 0.578363 16.021727 12.441602
Minghui 63 | MH63RS3 | HZAU OsMH63_02G0016200 RBH 1.134152 3.6844715 3.4322085
IR 64 | OsIR64RS1 | Gramene(+IsoSeq) OsIR64_02g0001370 SBH 0.000000 0.0 0.000000
Zhenshan 97 | ZS97RS3 | HZAU OsZS97_02G0016700 RBH 0.8110225 2.084876 5.635476
LIMA | Os127564RS1 | Gramene(+IsoSeq) OsLima_02g0001380 RBH 0.0 0.000000 None
KHAO YAI GUANG | Os127518RS1 | Gramene(+IsoSeq) OsKYG_02g0001330 RBH 0.0 0.0 None
GOBOL SAIL | Os132424RS1 | Gramene(+IsoSeq) OsGoSa_02g0001390 RBH 0.0 0.0 None
LIU XU | Os125827RS1 | Gramene(+IsoSeq) OsLiXu_02g0001450 SBH 0.0 0.000000 0.000000
LARHA MUGAD | Os125619RS1 | Gramene(+IsoSeq) OsLaMu_02g0001440 RBH 0.000000 0.0 None
N22 | OsN22RS2 | Gramene(+IsoSeq) OsN22_02G001410 RBH 0.0 0.000000 0.0
NATEL BORO | Os127652RS1 | Gramene(+IsoSeq) OsNaBo_02g0001380 RBH 0.623385 20.424784 0.0
Powered by

© 2021- Rice Gene Index @Zhang Lab. All Rights Reserved.

National Key Laboratory of Crop Genetic Improvement

Huazhong Agricultural University

Any comments and suggestions, please contact us.